Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Ndt80p
Description Meiosis-specific transcription factor required for exit from pachytene and for full meiotic recombination; activates middle sporulation genes; competes with Sum1p for binding to promoters containing middle sporulation elements (MSE)
Aminoacid Sequence
Download FASTA
>YHR124W NDT80
MNEMENTDPVLQDDLVSKYERELSTEQEEDTPVILTQLNEDGTTSNYFDKRKLKIAPRST
LQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTF
ETANCDLDTFLKSSFDLLVEDSSVESRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKG
PQFCPSVCPLVPSPLPKHQIIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFS
YPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDTFHGENPGIPYDEL
ALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQRITVRTPSSVNSSQNSTKRKMPSMA
QPLNESCLNARPSKRRSKVALGAPNSGASISPIKSRQSTPMEASKENEDPFFRPNKRVET
LEHIQNKLGALKNQCPDSSLKYPSSSSRGMEGCLEKEDLVYSSSFSVNMKQIELKPARSF
EHENIFKVGSLAFKKINELPHENYDITIEKKSMEQNYLRPEIGSRSECKTSYGNELSLSN
ISFSILPNSAENFHLETALFPATEEDVPRTFSRILETGSFQNYYQKMDAENADRVYSKGV
KLIASGTLPSGIFNREELFEEDSFYKY* 
Transcription Factor
Binding site(s)
CACAAA
GNCRCAAAW
HxtccggMCACAAAaacgVxa
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator