Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Nrg1p
Description Transcriptional repressor that recruits the Cyc8p-Tup1p complex to promoters; mediates glucose repression and negatively regulates a variety of processes including filamentous growth and alkaline pH response
Aminoacid Sequence
Download FASTA
>YDR043C NRG1
MFYPYNYSNLNVSTMPALPGISAFDGMQDEENVEISPERKYQTLLPVLTNSHVVENELKH
KLNKTAFDFRYQTKSENGSEKWEPKYLITPNLQTRSVSFDNSSVQYNSDSSEKSSLSQLT
CNSSIIQQPENGIVSNDAYNKMANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICA
RGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKKGQ* 
Transcription Factor
Binding site(s)
CCCCT
CCCTC
GGACCCT
gcVxWGGACCCTKatxxxg
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator