Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Nrg2p
Description Transcriptional repressor that mediates glucose repression and negatively regulates filamentous growth; has similarity to Nrg1p
Aminoacid Sequence
Download FASTA
>YBR066C NRG2
MSIGYKDNLMSTILAKDRKCEFPINFECSPSQITLMPEMFSFNNERKYQTLIPLMKTSHL
IDDDLKDKLNKCAFDFFSGKQANRTSDGTISRLTASGKTSPILPLQNINIVKAENTGNGK
SDPYSSIKISKPTKTVIKLKSTKTNTAGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKN
HICPHEGCGQRFSRHDNCNQHYRTHANKKKRNWKRREASS* 
Transcription Factor
Binding site(s)
MAGGGTCC
HAGGGtcB
BHAGGGtc
GGtcBHAG
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator