Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Nrg2p
Description Transcriptional repressor that mediates glucose repression and negatively regulates filamentous growth; has similarity to Nrg1p
Aminoacid Sequence
Download FASTA
>YBR066C NRG2
MSIGYKDNLMSTILAKDRKCEFPINFECSPSQITLMPEMFSFNNERKYQTLIPLMKTSHL
IDDDLKDKLNKCAFDFFSGKQANRTSDGTISRLTASGKTSPILPLQNINIVKAENTGNGK
SDPYSSIKISKPTKTVIKLKSTKTNTAGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKN
HICPHEGCGQRFSRHDNCNQHYRTHANKKKRNWKRREASS* 
Transcription Factor
Binding site(s)
MAGGGTCC
HAGGGtcB
BHAGGGtc
GGtcBHAG
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator