Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Oaf1p
Description Oleate-activated transcription factor, acts alone and as a heterodimer with Pip2p; activates genes involved in beta-oxidation of fatty acids and peroxisome organization and biogenesis
Aminoacid Sequence
Download FASTA
>YAL051W OAF1
MVENSTQKAPHAGNDDNSSTKPYSEAFFLGFNNPTPGLEAEHSSTSPAPENSETHNRKRN
RILFVCQACRKSKTKCDREKPECGRCVKHGLKCVYDVSKQPAPRIPSKDAIISRLEKDMF
YWKDKAMKLLTEREVNESGKRSASPINTNNASGDSPDTKKQHKMEPIYEQSGNGDINNGT
RNDIEINLYRSHPTMIMSKVMKREVKPLSENYIIIQDCFLKILVTSVFLDTSKNTMIPAL
TANANITRAQPSVANNLLKLKEMLIRQCQTEDEKNRVNEFTDRILQNTNSNRNLKIGMLL
SMLYNSVGYQYLEDHCPQGGEYSDLLRNLINECEAILPSYEIIERYKNHFYEYVYPSLPF
IELEIFEESLSQTIFPDPNNPSKVQIRMGSTHLRAKVENLSLLLVILKLSYMSIRFLDHS
TADSSFYLSKEIIDKYPIPNDFILLSQRCLASENWCACANENIISCLLYIWSFFAFSPEE
GDFFLEHPTDVISSLIMMLSTSIGLHRDPSDFPQLISPSTSDKRTLNHRRILWLSIVTVC
SFEASLKGRHSVSPISLMALFLNIKDPDSLTVYMNRVRGDLSDINNHKLLRIHKFTFKRA
QLALLLSDLDNLTMTYYGSFHLHSIEFIREKIEIFVEENFPIVPLKSVAQDKSDLDDMNV
ISEMNILSSENSSSFHNRIMNKLLMLRTSMAVFLHFETLITKDKSIFPFYKKYFMVSCMD
ALSLINYFNKFFNGEYRHAISSLTSFNVTKFIQLALSSTIFSLLGIILRIGLAIHMLSSE
VQKLSGTTDPRIKELNTKVEKFSTLQRDLESALEGIYCSASEHLRFTYFPVFKMLALFDV
IVQRMRKGELWHGIFTMIQMEQMHSRIIKTLSITLGVKLDKKDRLLEELMACNHVANFSV
EDIDELNRNIKKEIQISSGLKPPVNTIDLTNGEPFGNAVPTFTKTWSSSLDNLEKLSSAA
AVGQSLDYNSGLRQGPLAGGGSKEQTPIAGMNNLNNSINATPIVDNSSGSQLPNGFDRGQ
ANNTPFPGYFGGLDLFDYDFLFGNDFA* 
Transcription Factor
Binding site(s)
CGGN{3}TNRN{8,12}CCG
tCGGaxxta
tCGGRGata
atttCGGatWTAagxxxa
CGGNNNTAA
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator