Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Phd1p
Description Transcriptional activator that enhances pseudohyphal growth; physically interacts with the Tup1-Cyc8 complex and recruits Tup1p to its targets; regulates expression of FLO11, an adhesin required for pseudohyphal filament formation; similar to StuA, an A. nidulans developmental regulator; potential Cdc28p substrate
Aminoacid Sequence
Download FASTA
>YKL043W PHD1
MYHVPEMRLHYPLVNTQSNAAITPTRSYDNTLPSFNELSHQSTINLPFVQRETPNAYANV
AQLATSPTQAKSGYYCRYYAVPFPTYPQQPQSPYQQAVLPYATIPNSNFQPSSFPVMAVM
PPEVQFDGSFLNTLHPHTELPPIIQNTNDTSVARPNNLKSIAAASPTVTATTRTPGVSST
SVLKPRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRS
EKVREVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKPSNKASL
TPKSSPAPIKQEPSDNKHEIATEIKPKSIDALSNGASTQGAGELPHLKINHIDTEAQTSR
AKNELS* 
Transcription Factor
Binding site(s)
gMTGCAxg
SMTGCABc
cxDBcxtgATGCAtgBtcccY
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator