Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Pho4p
Description Basic helix-loop-helix (bHLH) transcription factor of the myc-family; activates transcription cooperatively with Pho2p in response to phosphate limitation; binding to 'CACGTG' motif is regulated by chromatin restriction, competitive binding of Cbf1p to the same DNA binding motif and cooperation with Pho2p,; function is regulated by phosphorylation at multiple sites and by phosphate availability
Aminoacid Sequence
Download FASTA
>YFR034C PHO4
MGRTTSEGIHGFVDDLEPKSSILDKVGDFITVNTKRHDGREDFNEQNDELNSQENHNSSE
NGNENENEQDSLALDDLDRAFELVEGMDMDWMMPSHAHHSPATTATIKPRLLYSPLIHTQ
SAVPVTISPNLVATATSTTSANKVTKNKSNSSPYLNKRRGKPGPDSATSLFELPDSVIPT
PKPKPKPKQYPKVILPSNSTRRVSPVTAKTSSSAEGVVVASESPVIAPHGSSHSRSLSKR
RSSGALVDDDKRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAAC
RYIRHLQQNVST* 
Transcription Factor
Binding site(s)
CACGTK
CACGTGGG
VCACGtg
gCACGtg
gxSCACGTGSttD
CRYRYgC
aCACGTGB
cACGTGt
CACGTGtV
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator