Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Pip2p
Description Autoregulatory oleate-specific transcriptional activator of peroxisome proliferation, contains Zn(2)-Cys(6) cluster domain, forms heterodimer with Oaf1p, binds oleate response elements (OREs), activates beta-oxidation genes
Aminoacid Sequence
Download FASTA
>YOR363C PIP2
MYFTDESSPAMNRVGKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFCIYDVARQA
APRNPNKDATIARLKKEIRYWRNKTVDLTQEKKDFYTALKRPTEELAARRTCKSLQENSF
PISLYKTHPRLIMTKVMKREINPLSEKYLIFQDTFLKTLIASVLLSCSRNSMIPALNADI
SRSRTQPCVKNNVVKMREVLLKNSKYESQRKSINEFTDRLLQRKNPEEQIAVNKVISLLY
SNRESSYLEDTCPTENDYSDLLKGYINEIEKTLPPKAIIEQYLSHFFEHIFHLIPFASKE
MLEESIHTTVQYNELGEVRLSMGTTLIRNKMENLCILLLILRIAYISLTFIEDKIEDYSP
YITKEMLEQYPIQSEVIFLAQQILASENWCACANENTISCLLYIWCAFVFSPTEGDFLLE
QPSDVIINLVILIGTSIGLHRDPSDFPALNHPEASDKRLLNLRRIQWLSIISMATLESSL
KGRLLVSPLSMIDLFIDVRDPNCVEIYKKRVKKDLTGSESDEQLLEIHEIFFHRAQLALF
LSDLNNITISYSGSVPMDTLETLRVKANELLKNKFQLRSVDINIYDEEKTFQKLTFNSIL
NSISLSGQILGKLMMLRASIALMLYFETLAMERSECLSFFYKYFFQCCADTISLIRFFFL
YFNGSYEKVLSSLVCFITTKVIQLAVPTTMFTLLVIIMRVELAKNMLLVKCNECNARGDI
SDLPEIKEKIKSLDTIKENFERLLLEVYLLASQNLRFKYFYIFKMLTLFDVFIQRLRKGQ
LFSGLFVKVDKDLTTKKIATMLELTLGINLDKSDHLIDRLKGKNLTVNFTLDQLYQIIKE
FDRIKNIGVADPQNSLNPSKPNMKDNTPTIELLLNSSVENESVPPYSSSNDPTNVGNAST
YSLAHNISNQNNEENMPPSIGSSESNRAAPNLNFMPINNNYNNSGSNINNNDNVKLPSNF
KNYYDPPMSSLDISMDVPDIFGSLDFFDYDLLFQND* 
Transcription Factor
Binding site(s)
CGGN{3}TNRN{8,12}CCG
CCGNNNTA
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator