Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Ppr1p
Description Zinc finger transcription factor containing a Zn(2)-Cys(6) binuclear cluster domain, positively regulates transcription of genes involved in uracil biosynthesis; activity may be modulated by interaction with Tup1p
Aminoacid Sequence
Download FASTA
>YLR014C PPR1
MKQKKFNSKKSNRTDLSKRGDSPNIGISKSRTACKRCRLKKIKCDQEFPSCKRCAKLEVP
CVSLDPATGKDVPRSYVFFLEDRLAVMMRVLKEYGVDPTKIRGNIPATSDDEPFDLKKYS
SVSSLGEEGILPHNGLLADYLVQKGNSMASSAITSKSMASPQTINVQRKEFLVNSKKQDG
SALLPETGSPMTSDARAEELRRCNKEISALGTMRESSFNSFLGDSSGISFAKLVFTATNF
RQDSGDDVLDEDIKQREQKYNGYAEAENNPHFDPLELPPRHAAEVMISRFFVDTNSQLPL
LHRELFLKKYFEPIYGPWNPNIALASDQTGINSAFEIPITSAFSAHTEPKRENVTEKIDV
CSSVDVPWYDTWETSQKVNMRPIVELPTKFHIPYFFLNIIFAIGHATQVLKSDITTVATY
KRRATKYIASLFSSSDRLEALAGTLLMVIYSIMRPNVPGVWYTMGSVLRLTVDLGLHSEK
INKNYDAFTREIRRRLFWCVYSLDRQICSYFGRPFGIPEESITTRYPSLLDDSFITLTNR
EIDDYSDLPSPNPSSKVIALAMYKIRRIQASIVRILYAPGAELPRRFMDLESWRIETYNE
LERWFQVDVPKNFEMMNCKFNSIWFDLNYHYSKSILYGLSPKFPTLNDTAFKIVLDSTKG
TIDVFYNLCVNKKIGYTWVAVHNMFMTGMTYLYVNFYSKNNINDCQEKVSEYTEKVLIVL
KNLIGFCESAKTCYTSYKILSSVVIKLKFMQINDAKGIFSDSNPLTSQANRMSSYDKKTN
VLGFDDGTFDNKVFNRTNFEEKAPFDIPLDEFFTELEKHSNVSQFNTLDVSEGNQVINES
ASTNTSSALNCQSYTNNQDIMDILFQVTSGSVWDEFFVRSGNGNEGESSYDISKGKNSES
GGIF* 
Transcription Factor
Binding site(s)
CGGN{6}CCG
See regulon   
See documented regulated genes
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator