Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Ppr1p
Description Zinc finger transcription factor containing a Zn(2)-Cys(6) binuclear cluster domain, positively regulates transcription of genes involved in uracil biosynthesis; activity may be modulated by interaction with Tup1p
Aminoacid Sequence
Download FASTA
>YLR014C PPR1
MKQKKFNSKKSNRTDLSKRGDSPNIGISKSRTACKRCRLKKIKCDQEFPSCKRCAKLEVP
CVSLDPATGKDVPRSYVFFLEDRLAVMMRVLKEYGVDPTKIRGNIPATSDDEPFDLKKYS
SVSSLGEEGILPHNGLLADYLVQKGNSMASSAITSKSMASPQTINVQRKEFLVNSKKQDG
SALLPETGSPMTSDARAEELRRCNKEISALGTMRESSFNSFLGDSSGISFAKLVFTATNF
RQDSGDDVLDEDIKQREQKYNGYAEAENNPHFDPLELPPRHAAEVMISRFFVDTNSQLPL
LHRELFLKKYFEPIYGPWNPNIALASDQTGINSAFEIPITSAFSAHTEPKRENVTEKIDV
CSSVDVPWYDTWETSQKVNMRPIVELPTKFHIPYFFLNIIFAIGHATQVLKSDITTVATY
KRRATKYIASLFSSSDRLEALAGTLLMVIYSIMRPNVPGVWYTMGSVLRLTVDLGLHSEK
INKNYDAFTREIRRRLFWCVYSLDRQICSYFGRPFGIPEESITTRYPSLLDDSFITLTNR
EIDDYSDLPSPNPSSKVIALAMYKIRRIQASIVRILYAPGAELPRRFMDLESWRIETYNE
LERWFQVDVPKNFEMMNCKFNSIWFDLNYHYSKSILYGLSPKFPTLNDTAFKIVLDSTKG
TIDVFYNLCVNKKIGYTWVAVHNMFMTGMTYLYVNFYSKNNINDCQEKVSEYTEKVLIVL
KNLIGFCESAKTCYTSYKILSSVVIKLKFMQINDAKGIFSDSNPLTSQANRMSSYDKKTN
VLGFDDGTFDNKVFNRTNFEEKAPFDIPLDEFFTELEKHSNVSQFNTLDVSEGNQVINES
ASTNTSSALNCQSYTNNQDIMDILFQVTSGSVWDEFFVRSGNGNEGESSYDISKGKNSES
GGIF* 
Transcription Factor
Binding site(s)
CGGN{6}CCG
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator