Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Put3p
Description Transcriptional activator of proline utilization genes, constitutively binds PUT1 and PUT2 promoter sequences and undergoes a conformational change to form the active state; has a Zn(2)-Cys(6) binuclear cluster domain
Aminoacid Sequence
Download FASTA
>YKL015W PUT3
MVTDQGSRHSIQSKQPAYVNKQPQKRQQRSSVACLSCRKRHIKCPGGNPCQKCVTSNAIC
EYLEPSKKIVVSTKYLQQLQKDLNDKTEENNRLKALLLERPVSVRGKDNSDDDERHINNA
PSSDTLEVSSAPAAPIFDLMSNSNTASDNDNDDDNSNRITNNRSYDHSLEKYYKKAISIF
KQPANANGENGNGANGHEDDDEDDEEISTNFAQRSGRLIESHNGFHYFVGSSSMTLFGLE
IQSLVTKYISVKNFRPLPINTKNKILNSNLNPAISSFINSNNYLFSSYNFLNPISTIVNL
NSINDNLSPLMFKIILKSDTDGSSGQEEVIQFQLPSYNYTKLLIDCFINYNDGCFYFFNE
GLVKCGINKLYLENKWLYYDNTKKALDNENDPILQAVWFCKILLILAVGEMYLGSINNEM
LKNYSNQPKLPGSKFFQMGSKIFNCLFSSERLENVTKKGGIEVLLLYAFFLQVADYTLAS
YFYFGQALRTCLILGLHVDSQSDTLSRYEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDY
TISTALPADIDDETIEEKNSHYVFRKAELISNCVTIVKINAQILSKLYQRQPETNIIITL
KVVIKQLLEWRNNLSDSLQVDFTQKDEDFKISRLSTNMFTEYFQGINLAVRPLLFHFASI
QLKRFKTSNTFVNLQNYSATISSLLTCSLHASVNTIRSLWSLLQNSMLAMFSYMDREYLF
TSSCTLLLFNTAFGIHEQTLYHLDHSLEIFTQMRNLGNIPAGLRRAQLLTLMANLDFHGI
MNDLITKYNDILKFDSMNCENDNIVEDSNEPKRETEKCKPHKDGDRIDPSIIDCDKSNTN
TNMIKNESISNIVSILPEGAKPTLTDYSNGNNDVNDINVNNSEPSTFFDIITASLENSYQ
TTLTEKGSQVMEKNMDQLDSVHNLNDDDLQQLLEDLGNIDHSDEKLWKEITDQAMWLGNT
MDPTAAAGSEIDFTDYLGP* 
Transcription Factor
Binding site(s)
CGGN{10}CCG
CGGRa
CGGRaaa
cCCGGGaa
axxxttccCGGGatxxxxat
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator