Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Rdr1p
Description Transcriptional repressor involved in the control of multidrug resistance; negatively regulates expression of the PDR5 gene; member of the Gal4p family of zinc cluster proteins
Aminoacid Sequence
Download FASTA
>YOR380W RDR1
MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQV
QQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCL
GLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFDVV
NPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYAKGILDDPT
FSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNNV
PPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNFTAHLVALA
HLIPQDSVNANAAQLLQALAAVHESPNAHPFLSLTKGDICLSLYRRLRLLNHILDKNVVL
QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVATAMKTLDNIT
QILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHLLDIDWDALLDPS
DTLNFM* 
Transcription Factor
Binding site(s)
WtCCGc
txxgxcxtGCGGAWAtxxxxc
tGCGGAAc
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator