Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Rds1p
Description Zinc cluster transcription factor involved in conferring resistance to cycloheximide
Aminoacid Sequence
Download FASTA
>YCR106W RDS1
MDSITVKKPRLRLVCLQCKKIKRKCDKLRPACSRCQQNSLQCEYEERTDLSANVAANDSD
GFNSSHKLNFEQQPVLERTGLRYSLQVPEGVVNATLSIWNAEDMLVIVGLVTFLDYPFAA
HSLAQHDQYIRALCASLYGMALVDFSNYANGIPCEDTSRSILGPLSFIEKAIFRRIEHSK
QFRVQSAALGLLYNAFSMEEENFSTLLPSLIAEVEDVLMQKKDCEILLRCFYQNIYPFYP
FMDISLFESDLTSLLLQDDNNRWKISTEVKNVRKKIETLSLLTIVMAMALMHSKLDANLL
SMVKENASESARKLSLLCHKLLCLLDVFRYPNENTFTCLLYFYVSEHLDPESPDCVLSPT
NLLTLHHLLNLSMTLGLQYEPSKYKRFKDPEVIRQRRILWLGVQSLLFQISLAEGDAGKS
NSEYMEAYLTDFEEYIEASSEYEKSSASESNVQMNDIVWNKYKFHVILSKLMSDCTSVIQ
HPQLFHILGNIKRSEDFMAENFPTSSIYQPLHEKEPNAIKVGKSTVLDVMDIQKTEIFLT
NIVGSMCFLNIFDVLSLHFEKKCVMHWEEYEKNYHFLTLKSFNAYLKLAGLISDYLENKF
QGNILESRGYIIDKQICFMLVRIWMFQCRILLRFSYKQESQKKLASSSISTNDNEKEDEM
IVILERLIKHIRNQMAHLVDLAKGKLQDSYFGAYQTVPMFRYVVYLIDVGGLVSVTNGFW
DKISSDGEIPPKVQQAVRLKWGLDCNNSRRIKQKLISSQSLQSFNQVLLCQMEDAVLSSS
FAIKANTAMSQNTAEEFFNISEEEALNQLLENNNFDAFWDLLGENLSDMPSL* 
Transcription Factor
Binding site(s)
BCGGCCG
gCGGV
ccBBTCGGCCGAaVDxcD
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator