Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Rds1p
Description Zinc cluster transcription factor involved in conferring resistance to cycloheximide
Aminoacid Sequence
Download FASTA
>YCR106W RDS1
MDSITVKKPRLRLVCLQCKKIKRKCDKLRPACSRCQQNSLQCEYEERTDLSANVAANDSD
GFNSSHKLNFEQQPVLERTGLRYSLQVPEGVVNATLSIWNAEDMLVIVGLVTFLDYPFAA
HSLAQHDQYIRALCASLYGMALVDFSNYANGIPCEDTSRSILGPLSFIEKAIFRRIEHSK
QFRVQSAALGLLYNAFSMEEENFSTLLPSLIAEVEDVLMQKKDCEILLRCFYQNIYPFYP
FMDISLFESDLTSLLLQDDNNRWKISTEVKNVRKKIETLSLLTIVMAMALMHSKLDANLL
SMVKENASESARKLSLLCHKLLCLLDVFRYPNENTFTCLLYFYVSEHLDPESPDCVLSPT
NLLTLHHLLNLSMTLGLQYEPSKYKRFKDPEVIRQRRILWLGVQSLLFQISLAEGDAGKS
NSEYMEAYLTDFEEYIEASSEYEKSSASESNVQMNDIVWNKYKFHVILSKLMSDCTSVIQ
HPQLFHILGNIKRSEDFMAENFPTSSIYQPLHEKEPNAIKVGKSTVLDVMDIQKTEIFLT
NIVGSMCFLNIFDVLSLHFEKKCVMHWEEYEKNYHFLTLKSFNAYLKLAGLISDYLENKF
QGNILESRGYIIDKQICFMLVRIWMFQCRILLRFSYKQESQKKLASSSISTNDNEKEDEM
IVILERLIKHIRNQMAHLVDLAKGKLQDSYFGAYQTVPMFRYVVYLIDVGGLVSVTNGFW
DKISSDGEIPPKVQQAVRLKWGLDCNNSRRIKQKLISSQSLQSFNQVLLCQMEDAVLSSS
FAIKANTAMSQNTAEEFFNISEEEALNQLLENNNFDAFWDLLGENLSDMPSL* 
Transcription Factor
Binding site(s)
BCGGCCG
gCGGV
ccBBTCGGCCGAaVDxcD
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator