Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Rds2p
Description Transcription factor involved in regulating gluconeogenesis and glyoxylate cycle genes; member of the zinc cluster family of proteins; confers resistance to ketoconazole
Aminoacid Sequence
Download FASTA
>YPL133C RDS2
MSANSGVKRASKAFKTCLFCKRSHVVCDKQRPCSRCVKRDIAHLCREDDIAVPNEMPSQH
ESSPNDNNIQGKYANKAHTGIPSDYQNEPVNKSGSTYGEELSPKLDSSLVNDTTSLLLPQ
QPVFVSENVGSEFSSLNEFLSMLENPLLTQTSLSSSSASNVHLENGSQTTQSPLEYQNDN
RRDEIGVARQENRSPTIMSGSSNSISKGDKQDQEKEESRILANANENSAPTPKEQFFLTA
ADPSTEMTPEHRLKLVINAKLEAGLLKPYNYAKGYARLQDYMDKYMNQSSKQRILKPLST
IRPAFRTIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLCRRTGEIYRANKEFAS
LVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCSLRTKDGIRKRP
CCFSFTIRRDRYNIPICIVGNFIPLS* 
Transcription Factor
Binding site(s)
YCCGa
axxxxgaAAaYCCGAgxxxxt
cCCCGAB
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator