Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Rgm1p
Description Putative transcriptional repressor with proline-rich zinc fingers; overproduction impairs cell growth
Aminoacid Sequence
Download FASTA
>YMR182C RGM1
MRGKQPKRNKDNASVKRNYRCVGYPDCNMSFNRTEHLARHIRKHTGEKPFQCNICLKFFS
RIDNLRQHQSSVHSDVDLMSLRRLQQSANSTANDPNATRMFPQLRPYGIVVQPAPVPYNL
PISTPASPQDTISLYAPPYFPHPMPSAPIPLPHQPPPLPIYSYMQPLFLNHTPIQNHNIV
ELPPDSSDTPASPSKVQSFDQAKDASPNAKK* 
Transcription Factor
Binding site(s)
CCCCT
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator