Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Rgt1p
Description Glucose-responsive transcription factor that regulates expression of several glucose transporter (HXT) genes in response to glucose; binds to promoters and acts both as a transcriptional activator and repressor
Aminoacid Sequence
Download FASTA
>YKL038W RGT1
MNELNTVSTNSSDSTKNGGTSNSPDDMDSAAAASHAIKKRTKASRACDQCRKKKIKCDYK
DEKGVCSNCQRNGDRCSFDRVPLKRGPSKGYTRSTSHPRTNEIQDHNNSRSYNTFDNSNN
TLNNNTGNSGDNGINSNTVPSTPSRSNSVLLPPLTQYIPQAGGIPPSFQNPAIQSTMPAG
NIGQQQFWKVPYHEFQHQRKGSIDSLQSDISVRTLNPNEQLSYNTVQQSPITNKHTNDSG
NANGSVTGSGSASGSGGYWSFIRTSGLLAPTDDHNGEQTRRSSSIPSLLRNTSNSLLLGG
QPQLPPPQQQSQPQAHQQKLQQGQNLYSYSQFSQQQPYNPSISSFGQFAANGFHSRQGSV
ASEAMSPSAPAMFTSTSTNPVNVAQQTQRPQGQQVPQFSSELDGNKRRQSAPVSVTLSTD
RLNGNENNNGEINNNNGSNNSGSSKDTSQHSQESVTTPAALEASSPGSTPQRSTKKRRKS
YVSKKTKPKRDSSISITSKDSAHPMTTSSTIAYGQISDVDLIDTYYEFIHVGFPIIPLNK
TTLTSDLLLVNTQPISNIHEVNSYVILWFRNSLELLVRVALKQKPGGKFFDNIVGVALSP
SNDNNKAGFTTATARDDAEKTRRDSHNEVQDTLEVQSVFIAALNECFQKIVDIHPKFREN
NDQISPKIKVIYLSTFILLNYILAFVGYDNSFVLGMSVTIFNEFKLYKLLLFPEPDINDV
KPPVDEEVSTGNGNTKTSEFEIGSESAGHMNPSNSPNSMDENISHYSVLFKRLYVLLSVF
DSLQSCAFGGPKLLNISIQGSTERFFSNDLGSKWCLEQSQLRLKSVLQSLKLGELMSELT
RNRISMNGNRKPGFDITNSSSLLSEYVETQPLSVAQLFCKLLIGKHNFINCLLSLYDSEA
GVYSDLTLDLSSKIADSLCSLISIILQVLTLILRLNPTNSIDFNYRPPNPPANNPTVQEG
PSAMGSSPVAGNLSAAPPSEGNPDFYKKLLGLKQDTGTILSDLCRGIISPFAIAILHEVY
NITELVKQMPTSLISIMMTATTTQNTQDTKKSQDLVMKLSNSMNEVVQITSVLTMIKPFK
IFEHELNKPIMSLTGGLSSTTRNDVMWPKSGQGLRESSVMKTLLDERRTSGTQPTTAPVA
AEEPRLENVALENFVSIGWKLLDDSELGWY* 
Transcription Factor
Binding site(s)
CGGANNA
CGGAWHAWHt
CGGAWHAWYt
CGGAaaAWHt
DcxxcCGGAaaAAYttxxa
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator