Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Rlm1p
Description MADS-box transcription factor, component of the protein kinase C-mediated MAP kinase pathway involved in the maintenance of cell integrity; phosphorylated and activated by the MAP-kinase Slt2p
Aminoacid Sequence
Download FASTA
>YPL089C RLM1
MGRRKIEIQRISDDRNRAVTFIKRKAGLFKKAHELSVLCQVDIAVIILGSNNTFYEFSSV
DTNDLIYHYQNDKNLLHEVKDPSDYGDFHKSASVNINQDLLRSSMSNKPSKSNVKGMNQS
ENDDDENNDEDDDDHGNFERNSNMHSNKKASDKNIPSAHMKLLSPTALISKMDGSEQNKR
HPENALPPLQHLKRLKPDPLQISRTPQQQQQQNISRPYHSSMYNLNQPSSSSSSPSTMDF
PKLPSFQNSSFNGRPPPISISPNKFSKPFTNASSRTPKQEHKINNSGSNNNDNSNYTQSP
SNSLEDSIQQTVKARRKLSARPVLRVRIPNNNFSSNSAIPSEPSSASSTSANGNSMGSSQ
IMKENKTSRSSKISPLSASASGPLTLQKGNNGRMVIKLPNANAPNGSNNGNGSNNNNHPY
PFGSGSSPLFSATQPYIATPLQPSNIPGGPFQQNTSFLAQRQTQQYQQMSFKKQSQTVPL
TTTLTGRPPSTFSGPETSNGPPTGSLPSKFVHDLMSNSPNVSSISMFPDWSMGPNSAKPG
NTNNPGTFPPVQTAVNNGNSSNISSTNNTNNNNNNNNNNSSNNNSNNGNDNNSNNSNNSY
YSNNEDAPVNGAAISEHTTDGDSNNQSNSSTYDAAATAYNGNTGLTPYINTAQTPLGTKF
FNFSTDISGEKNSSKI* 
Transcription Factor
Binding site(s)
CTAWWWWTAG
TAWWWWTAGM
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator