Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Rof1p
Description Putative protein of unknown function; overexpression causes a cell cycle delay or arrest
Aminoacid Sequence
Download FASTA
>ROF1 YHR177W
MMDISPTCYGYIDDEQDLALVFQGVFNGNLRCIERRPYDAEKVELVNPGNIFVFNEEKSG
IKRWTDGFSWSPSRISGKFLVYREYNRLGSTHDLPLHNVPEYNIFERAHRKYFYTGLLKK
TFSLKFNMDPTDSTKLETFHLIAYYTEKDIHQGSLRRPSENPFFHKFRPSQKLLDALQKV
AVGNGRSNPSKNNERGRTKAHNYKTRRSLSSSPSYCDLLSNYNNHPGNIPVRTAVQLPLT
TFNNAPREMHQQQHRQQQQYLLPIDEQNKLPLPYMQHQPQPIGVYNPNYQPGLRRTVSQP
MIFCNTYNTLPQQPTAAPYERRGVSPSVIYSSNTLSPIPYQNIDPYSSRSGPECNHSKAP
IAPTMMPPVHHILVHDYRQPKPVTDSINPPNVNITTSTTNKNLDGIYILPAPRMNPPAQT
QYQMIHAPDSMQHPPTFSKNNTSSNPKSHQYSK* 
Transcription Factor
Binding site(s)
TTAAGGTT
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator