Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Rsf2p
Description Zinc-finger protein involved in transcriptional control of both nuclear and mitochondrial genes, many of which specify products required for glycerol-based growth, respiration, and other functions
Aminoacid Sequence
Download FASTA
>RSF2 YJR127C
MEPFAFGRGAPALCILTAAARINLDNFVPCCWALFRLSFFFPLDPAYIRNENKETRTSWI
SIEFFFFVKHCLSQHTFFSKTLAPKRNFRAKKLKDIGDTRIDRADKDFLLVPEPSMFVNG
NQSNFAKPAGQGILPIPKKSRIIKTDKPRPFLCPTCTRGFVRQEHLKRHQHSHTREKPYL
CIFCGRCFARRDLVLRHQQKLHAALVGTGDPRRMTPAPNSTSSFASKRRHSVAADDPTDL
HIIKIAGNKETILPTPKNLAGKTSEELKEAVVALAKSNNVELPVSAPVMNDKREKTPPSK
AGSLGFREFKFSTKGVPVHSASSDAVIDRANTPSSMHKTKRHASFSASSAMTYMSSSNSP
HHSITNFELVEDAPHQVGFSTPQMTAKQLMESVSELDLPPLTLDEPPQAIKFNLNLFNND
PSGQQQQQQQQQQNSTSSTIVNSNNGSTVATPGVYLLSSGPSLTDLLTMNSAHAGAGGYM
SSHHSPFDLGCFSHDKPTVSEFNLPSSFPNTIPSNSTTASNSYSNLANQTYRQMSNEQPL
MSLSPKNPPTTVSDSSSTINFNPGTNNLLEPSMEPNDKDSNIDPAAIDDKWLSEFINNSD
PKSTFKINFNHFNDIGFIYSPPSSRSSIPNKSPPNHSATSLNHEKASLSPRLNLSLNGST
DLPSTPQNQLKEPSYSDPISHSSHKRRRDSVMMDYDLSNFFSSRQLDISKVLNGTEQNNS
HVNDDVLTLSFPGETDSNATQKQLPVLTPSDLLSPFSVPSVSQVLFTNELRSMMLADNNI
DSGAFPTTSQLNDYVTYYKEEFHPFFSFIHLPSIIPNMDSYPLLLSISMVGALYGFHSTH
AKVLANAASTQIRKSLKVSEKNPETTELWVIQTLVLLTFYCIFNKNTAVIKGMHGQLTTI
IRLLKASRLNLPLESLCQPPIESDHIMEYENSPHMFSKIREQYNAPNQMNKNYQYFVLAQ
SRIRTCHAVLLISNLFSSLVGADCCFHSVDLKCGVPCYKEELYQCRNSDEWSDLLCQYKI
TLDSKFSLIELSNGNEAYENCLRFLSTGDSFFYGNARVSLSTCLSLLISIHEKILIERNN
ARISNNNTNSNNIELDDIEWKMTSRQRIDTMLKYWENLYLKNGGILTPTENSMSTINANP
AMRLIIPVYLFAKMRRCLDLAHVIEKIWLKDWSNMNKALEEVCYDMGSLREATEYALNMV
DAWTSFFTYIKQGKRRIFNTPVFATTCMFTAVLVISEYMKCVEDWARGYNANNPNSALLD
FSDRVLWLKAERILRRLQMNLIPKECDVLKSYTDFLRWQDKDALDLSALNEEQAQRAMDP
NTDINETIQLIVAASLSSKCLYLGVQILGDAPIWPIILSFAHGLQSRAIYSVTKKRNTRI
* 
Transcription Factor
Binding site(s)
ttCCCCgCa
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
External source Open in SGD external link
w3c xhtml validator w3c css validator