Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Rtg1p
Description Transcription factor (bHLH) involved in interorganelle communication between mitochondria, peroxisomes, and nucleus
Aminoacid Sequence
Download FASTA
>YOL067C RTG1
MSSIPAGTDPGSCGANFKNDRKRRDKINDRIQELLSIIPKDFFRDYYGNSGSNDTLSEST
PGALGLSSKAKGTGTKDGKPNKGQILTQAVEYISHLQNQVDTQNREEVELMVKATQLAKQ
TGTIVNDINLENTSAEVALSRIGVGPLAATNDDSVRPPAKRLSSFEYGGYGEYGNGS* 
Transcription Factor
Binding site(s)
GTCAC
GGTAC
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator