Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Rtg1p
Description Transcription factor (bHLH) involved in interorganelle communication between mitochondria, peroxisomes, and nucleus
Aminoacid Sequence
Download FASTA
>YOL067C RTG1
MSSIPAGTDPGSCGANFKNDRKRRDKINDRIQELLSIIPKDFFRDYYGNSGSNDTLSEST
PGALGLSSKAKGTGTKDGKPNKGQILTQAVEYISHLQNQVDTQNREEVELMVKATQLAKQ
TGTIVNDINLENTSAEVALSRIGVGPLAATNDDSVRPPAKRLSSFEYGGYGEYGNGS* 
Transcription Factor
Binding site(s)
GTCAC
GGTAC
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator