Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Rtg3p
Description Basic helix-loop-helix-leucine zipper (bHLH/Zip) transcription factor that forms a complex with another bHLH/Zip protein, Rtg1p, to activate the retrograde (RTG) and TOR pathways
Aminoacid Sequence
Download FASTA
>YBL103C RTG3
MMNNNESEAENQRLLDELMNQTKVLQETLDFSLVTPTPHHNDDYKIHGSAYPGGETPAQQ
HEKLSYINTHNSNDNNNLMGSQARSNSQTPTASTIYEEAESQSSYLDDMFRTSQGGRPVT
QNSISSIGQGPLRSSYSMAYDSPVDRAMNTPLQQQEGLKAELPHDFLFQHGTDDTMYNLT
DDLSSSLSSSINSDMMTPNTYSSSFSYNPQSLGPASVSSTYSPKVRSPSSSFRAGSFLSS
SFRHGSINTPRTRHTSISSNMTENIGPGSVPKILGGLTSDEKLRRKREFHNAVERRRREL
IKQKIKELGQLVPPSLLNYDDLGKQIKPNKGIILDRTVEYLQYLAEILEIQARKKKALLA
KIKELEEKKSSVAALSPFTNNHHASSGQNNSENSEERIIDIRSVPNALMNEQNSKAELHN
WEPPLYDSVGNHNHAGTMESHPHTNIHEELKEFLSGDLIEAEDNAKLMFGDDNSNPADYL
LEFGSG* 
Transcription Factor
Binding site(s)
GTCAC
GGTAC
gaxtaxgCACGTGctaxBxt
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator