Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Sfl1p
Description Transcriptional repressor and activator; involved in repression of flocculation-related genes, and activation of stress responsive genes; negatively regulated by cAMP-dependent protein kinase A subunit Tpk2p
Aminoacid Sequence
Download FASTA
>YOR140W SFL1
MSEEETVSAPAPASTPAPAGTDVGSGGAAAGIANAGAEGGDGAEDVKKHGSKMLVGPRPP
QNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLN
IYGFHKVSHDHSSNDANSGDDANTNDDSNTHDDNSGNKNSSGDENTGGGVQEKEKSNPTK
IWEFKHSSGIFKKGDIEGLKHIKRRASSRNNSSINSRKNSSNQNYDIDSGARVRPSSIQD
PSTSSNSFGNFVPQIPGANNSIPEYFNNSHVTYENANHAPLESNNPEMQEQNRPPNFQDE
TLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSENIVKDHQKQLQAFES
DMLTFKQHVMSRAHRTIDSLCAVNAAATAASVAPAPAPTSTSAYAPKSQYEMMVPPGNQY
VPQKSSSTTNIPSRFNTASVPPSQLFVQYQPQSQQHVTYAKQPAHVPNFINQPIPIQQLP
PQYADTFSTPQMMHNPFASKNNNKPGNTKRTNSVLMDPLTPAASVGVQGPLNYPIMNINP
SVRDYNKPVPQNMAPSPIYPINEPTTRLYSQPKMRSLGSTSSLPNDRRNSPLKLTPRSSL
NEDSLYPKPRNSLKSSISGTSLSSSFTLVANNPAPIRYSQQGLLRSLNKAANCAPDSVTP
LDSSVLTGPPPKNMDNLPAVSSNLINSPMNVEHSSSLSQAEPAPQIELPQPSLPTTSTTK
NTGEADNSKRKGSGVYSLLNQEDSSTSSADPKTEDKAAPALKKVKM* 
Transcription Factor
Binding site(s)
AGAANTTCC
tHxHDxataGAAGaaataWDW
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator