Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Sfp1p
Description Transcription factor that controls expression of ribosome biogenesis genes in response to nutrients and stress, regulates G2/M transitions during mitotic cell cycle and DNA-damage response, modulates cell size; regulated by TORC1 and Mrs6p; can form the [ISP+] prion
Aminoacid Sequence
Download FASTA
>YLR403W SFP1
MDFTTMTMASNMATSTTTTATSAHASINSSSNFNIDIDSNQNTPSILINNNSDSSNGKNT
DFNGVNNIHQKNIMNNTNNVHLYSPNIMDQTLLTPQDIAKLRRESIAHSQGMGGVSWGSI
SVGSWLRDEIISRRNSIVPASANGAASAAASATTTATNTLQIQQPTKRPSVSNPPYHRGY
SISPQIAYTAYLPNLEKQYCKDYSCCGLSLPGLHDLLRHYEEAHISTSPNTTNMSQIPMN
SAGNTSSSVRMTNNTSSANYNLQNNMAANTKNAGHKTNTMQAHSSNATNNTSINNMHANL
QSNMDSNSTIRQSQHPHHQQNIIQQQLQSNSVNHTSGAVPTPSVMGSATASSTTANPNVI
SITGAPNSGLSMANHSQQLHLNGNLVDAVSTNDVFLRTSNSPSRHVPHNKQINSNNNSGI
NINNNTSHNSNINMGSKNAMVNRPHTFNNYSLNKTSRNPIQHQSRKIDPHQTDLSPLVLV
QDIDLSFMDDDILGPSNHNSMNSVVNPTTGSHNYNTFHSSVHAKSSQNMVEDQDIDDIDD
DDDVDDDDDDDDDDDTENGSSSNGKSVHNNNYKMPQQAYIDDPARRLYVMDHEEQKPFKC
PVIGCEKTYKNQNGLKYHRLHGHQNQKLHENPDGTFSVIDPDSTDSFGDGMGSAKDKPYR
CEVCGKRYKNLNGLKYHRGHSTH* 
Transcription Factor
Binding site(s)
cHgxRRAAAAWTTTTYHxxxt
Vxxxxaxxa
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator