Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Sip4p
Description C6 zinc cluster transcriptional activator that binds to the carbon source-responsive element (CSRE) of gluconeogenic genes; involved in the positive regulation of gluconeogenesis; regulated by Snf1p protein kinase; localized to the nucleus
Aminoacid Sequence
Download FASTA
>YJL089W SIP4
MAKRKYGRSYSLDDTDSCSNKVLIVPTGQSSSNAITDFSVRKAHACDRCRLKKIKCDGLK
PNCSNCAKIDFPCKTSDKLSRRGLPKGYTELLEKEVVRLTNMNASSSANANSNLPFINDT
FYCFDNYNTQSENQRFLGHLTWNILTNTFPTQKAVVFTDDRNNIDLQLQLLTNFLNLNGD
FNHLPNFLLLKYDYNLQFLKNLLSVIIKDFFKRQNSLLLLLYPTNLWKNLLLDKINSTAM
TGEPITLLALLYIIQFTWSCFDDFKLFKVTKLIVSLTTNSKLDLKVLQLVNLSIFYFMGA
SVDSCKSKSSLTEHSNVNSVIWTNDLLNLNFTNILNMGLYINPKNLIPISGNNNNNKSNE
EDDRIVTFWCFQFLSSWWSLIQGLPKSNFLTEEFQPKSISVLEIPRLKPFEILLNFIIYS
LDGCNLLNISSLNVSDPNFQFFQNELESFKKNLLLWNLYHNLSDHDNFRFLTSSSNKKLT
TNLLLKNLTGLNHKLNQPDFVEIQLTLFYLSLKLMTLKEGDQDLKKEDISLEILSLYFLI
LTDDSNNDDNQQLQPQQLNLYHFTPFNSIDIIDLCLNNLNNWSLSLKYESGQNQPHSSKI
KFEKFQNFLNHWCPIWYYDEFSTNPFLQILKINFKLLPFETIHYSQEEQRLLISLNKLRY
LDAVSSFNSSSVKSNFASKVNTQLNLLQHSSSNSNFLDASPYDFNKIFMNNFENYDYETD
EGYAEDDDEEDSDSDNSLPLEIPFKKSKNKCKNRNKELSQRLSLFENRDSNSVDFNTDTN
LNLNPDSPSVTSSKKKYLDHIILDNRDIVSNHDSSKQKFKIQNILNSTF* 
Transcription Factor
Binding site(s)
TCCATTSRTCCGR
NCCDTYNVNCCGN
YCCNYTNRRCCGN
tcCGGRg
ccxxHxtTCCGGAaaxHxxc
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator