Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Sko1p
Description Basic leucine zipper transcription factor of the ATF/CREB family; forms a complex with Tup1p and Cyc8p to both activate and repress transcription; cytosolic and nuclear protein involved in osmotic and oxidative stress responses
Aminoacid Sequence
Download FASTA
>YNL167C SKO1
MSSEERSRQPSTVSTFDLEPNPFEQSFASSKKALSLPGTISHPSLPKELSRNNSTSTITQ
HSQRSTHSLNSIPEENGNSTVTDNSNHNDVKKDSPSFLPGQQRPTIISPPILTPGGSKRL
PPLLLSPSILYQANSTTNPSQNSHSVSVSNSNPSAIGVSSTSGSLYPNSSSPSGTSLIRQ
PRNSNVTTSNSGNGFPTNDSQMPGFLLNLSKSGLTPNESNIRTGLTPGILTQSYNYPVLP
SINKNTITGSKNVNKSVTVNGSIENHPHVNIMHPTVNGTPLTPGLSSLLNLPSTGVLANP
VFKSTPTTNTTDGTVNNSISNSNFSPNTSTKAAVKMDNPAEFNAIEHSAHNHKENENLTT
QIENNDQFNNKTRKRKRRMSSTSSTSKASRKNSISRKNSAVTTAPAQKDDVENNKISNNV
TLDENEEQERKRKEFLERNRVAASKFRKRKKEYIKKIENDLQFYESEYDDLTQVIGKLCG
IIPSSSSNSQFNVNVSTPSSSSPPSTSLIALLESSISRSDYSSAMSVLSNMKQLICETNF
YRRGGKNPRDDMDGQEDSFNKDTNVVKSENAGYPSVNSRPIILDKKYSLNSGANISKSNT
TTNNVGNSAQNIINSCYSVTNPLVINANSDTHDTNKHDVLSTLPHNN* 
Transcription Factor
Binding site(s)
TGACGTTT
TGACGTCA
TTACGTAA
ATGACGTA
aaTgACGt
aTKACGta
TgACGtaa
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator