Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Sko1p
Description Basic leucine zipper transcription factor of the ATF/CREB family; forms a complex with Tup1p and Cyc8p to both activate and repress transcription; cytosolic and nuclear protein involved in osmotic and oxidative stress responses
Aminoacid Sequence
Download FASTA
>YNL167C SKO1
MSSEERSRQPSTVSTFDLEPNPFEQSFASSKKALSLPGTISHPSLPKELSRNNSTSTITQ
HSQRSTHSLNSIPEENGNSTVTDNSNHNDVKKDSPSFLPGQQRPTIISPPILTPGGSKRL
PPLLLSPSILYQANSTTNPSQNSHSVSVSNSNPSAIGVSSTSGSLYPNSSSPSGTSLIRQ
PRNSNVTTSNSGNGFPTNDSQMPGFLLNLSKSGLTPNESNIRTGLTPGILTQSYNYPVLP
SINKNTITGSKNVNKSVTVNGSIENHPHVNIMHPTVNGTPLTPGLSSLLNLPSTGVLANP
VFKSTPTTNTTDGTVNNSISNSNFSPNTSTKAAVKMDNPAEFNAIEHSAHNHKENENLTT
QIENNDQFNNKTRKRKRRMSSTSSTSKASRKNSISRKNSAVTTAPAQKDDVENNKISNNV
TLDENEEQERKRKEFLERNRVAASKFRKRKKEYIKKIENDLQFYESEYDDLTQVIGKLCG
IIPSSSSNSQFNVNVSTPSSSSPPSTSLIALLESSISRSDYSSAMSVLSNMKQLICETNF
YRRGGKNPRDDMDGQEDSFNKDTNVVKSENAGYPSVNSRPIILDKKYSLNSGANISKSNT
TTNNVGNSAQNIINSCYSVTNPLVINANSDTHDTNKHDVLSTLPHNN* 
Transcription Factor
Binding site(s)
TGACGTCA
TTACGTAA
TGACGTTT
ATGACGTA
aaTgACGt
aTKACGta
TgACGtaa
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator