Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Smp1p
Description Putative transcription factor involved in regulating the response to osmotic stress; member of the MADS-box family of transcription factors
Aminoacid Sequence
Download FASTA
>YBR182C SMP1
MGRRKIEIEPIKDDRNRTVTFIKRKAGLFKKAHELSVLCQVDIAVIILGSNNTFYEYSSV
DMSNLLNVHQNNTDLPHNIIEPSDYGDYVKKPRVVLNERKRRRRRATVLQPASHSGSCTV
SSQDSSSVQNNGNLSAPLASNDAGNAGVSTPLVHCHGAISRSGSNHSDCARNSADYQMLQ
GGLNSGGSFHANDYKESVDQQHVANEAIHRNFMNKRIRPDTHLLLSESNHSNYHNFYPSP
YENLPKPSLPASLVGNIPSFQSQFVQVIPANSNPMGKGFNGTGDSESFEAKQKIHPTVAI
SNTLEGPAPVQAMVHHLHQLNSNRGKLSGKPYLKLNIPKATNDACQRSPAMYSGTASPKT
DVQATPNQMLASNMSSPLSRSKFLGFKNNDMDDLYHNGRCGSTYVNNKTFFLKPPIGRPP
KFPKSPSSSIVVFPSSVASSTLKSTSSTNSPD* 
Transcription Factor
Binding site(s)
ACTACTAWWWWTAG
gctxatWtAATTataggtxa
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator