Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Smp1p
Description Putative transcription factor involved in regulating the response to osmotic stress; member of the MADS-box family of transcription factors
Aminoacid Sequence
Download FASTA
>YBR182C SMP1
MGRRKIEIEPIKDDRNRTVTFIKRKAGLFKKAHELSVLCQVDIAVIILGSNNTFYEYSSV
DMSNLLNVHQNNTDLPHNIIEPSDYGDYVKKPRVVLNERKRRRRRATVLQPASHSGSCTV
SSQDSSSVQNNGNLSAPLASNDAGNAGVSTPLVHCHGAISRSGSNHSDCARNSADYQMLQ
GGLNSGGSFHANDYKESVDQQHVANEAIHRNFMNKRIRPDTHLLLSESNHSNYHNFYPSP
YENLPKPSLPASLVGNIPSFQSQFVQVIPANSNPMGKGFNGTGDSESFEAKQKIHPTVAI
SNTLEGPAPVQAMVHHLHQLNSNRGKLSGKPYLKLNIPKATNDACQRSPAMYSGTASPKT
DVQATPNQMLASNMSSPLSRSKFLGFKNNDMDDLYHNGRCGSTYVNNKTFFLKPPIGRPP
KFPKSPSSSIVVFPSSVASSTLKSTSSTNSPD* 
Transcription Factor
Binding site(s)
ACTACTAWWWWTAG
gctxatWtAATTataggtxa
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator