Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Stb3p
Description Ribosomal RNA processing element (RRPE)-binding protein involved in the glucose-induced transition from quiescence to growth; restricted to nucleus in quiescent cells, released into cytoplasm after glucose repletion; binds Sin3p
Aminoacid Sequence
Download FASTA
>YDR169C STB3
MSENQKEVSPPQAISVKSEASSSIFSKPISTSSPAGLAAAQRVTPGKLSTLLLEMGPLAI
RHITQTLCLDIPCFKDLSSSKQRRLIMSAMESGDKEKSVVFEKIGWGQWSAKRVDPANFD
KELEATNFANAKVKDLISQESQRRKSNNSNSNSGGKVEMPMKVEHNITNIDGATTPPTAV
ASTTIPVNIKRSKSPLAAANVVYIDENALASEDEDEEFDEDDHHLHYQNKSRNSSNNFGK
SSNGDPYSFGRRRSQVVFADSTPENIEHEIIAQKIRPLLRNRRRSSIKPHTPFISKLNTH
QDSSYLSPNTTSTTTPSNNNSNSNQAKIDLEKLTATSEPTSRRASRLSVSKESSIRSTLF
PNKNYLIVTTNPNSKATSVSTSPKLEEQMNVSSNPIVLSDKEKHRVASQHLNGESSPQLV
PHSHHQPHSDTDEEDWESIGAASLRNNSLAPNIDSVASSTNGVVSPKPTNPSFTNSQNGD
IEPPLQHDQQKHEQQPRNGEDNSAAFLLMSLKS* 
Transcription Factor
Binding site(s)
aattTTtCA
gtHHaaAWTTTTTCAct
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator