Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Stb5p
Description Transcription factor, involved in regulating multidrug resistance and oxidative stress response; forms a heterodimer with Pdr1p; contains a Zn(II)2Cys6 zinc finger domain that interacts with a pleiotropic drug resistance element in vitro
Aminoacid Sequence
Download FASTA
>YHR178W STB5
MDGPNFAHQGGRSQRTTELYSCARCRKLKKKCGKQIPTCANCDKNGAHCSYPGRAPRRTK
KELADAMLRGEYVPVKRNKKVGKSPLSTKSMPNSSSPLSANGAITPGFSPYENDDAHKMK
QLKPSDPINLVMGASPNSSEGVSSLISVLTSLNDNSNPSSHLSSNENSMIPSRSLPASVQ
QSSTTSSFGGYNTPSPLISSHVPANAQAVPLQNNNRNTSNGDNGSNVNHDNNNGSTNTPQ
LSLTPYANNSAPNGKFDSVPVDASSIEFETMSCCFKGGRTTSWVREDGSFKSIDRSLLDR
FIAAYFKHNHRLFPMIDKIAFLNDAATITDFERLYDNKNYPDSFVFKVYMIMAIGCTTLQ
RAGMVSQDEECLSEHLAFLAMKKFRSVIILQDIETVRCLLLLGIYSFFEPKGSSSWTISG
IIMRLTIGLGLNRELTAKKLKSMSALEAEARYRVFWSAYCFERLVCTSLGRISGIDDEDI
TVPLPRALYVDERDDLEMTKLMISLRKMGGRIYKQVHSVSAGRQKLTIEQKQEIISGLRK
ELDEIYSRESERRKLKKSQMDQVERENNSTTNVISFHSSEIWLAMRYSQLQILLYRPSAL
MPKPPIDSLSTLGEFCLQAWKHTYTLYKKRLLPLNWITLFRTLTICNTILYCLCQWSIDL
IESKIEIQQCVEILRHFGERWIFAMRCADVFQNISNTILDISLSHGKVPNMDQLTRELFG
ASDSYQDILDENNVDVSWVDKLV* 
Transcription Factor
Binding site(s)
TCTCCGCGAAC
CGGNS
CGGxgtTA
CGGKGTTATa
CGGcACTAt
CGGtgtta
gHKaCGGt
tgHtaCGG
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator