Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Stp1p
Description Transcription factor, undergoes proteolytic processing by SPS (Ssy1p-Ptr3p-Ssy5p)-sensor component Ssy5p in response to extracellular amino acids; activates transcription of amino acid permease genes and may have a role in tRNA processing
Aminoacid Sequence
Download FASTA
>YDR463W STP1
MPSTTLLFPQKHIRAIPGKIYAFFRELVSGVIISKPDLSHHYSCENATKEEGKDAADEEK
TTTSLFPESNNIDRSLNGGCSVIPCSMDVSDLNTPISITLSPENRIKSEVNAKSLLGSRP
EQDTGAPIKMSTGVTSSPLSPSGSTPEHSTKVLNNGEEEFICHYCDATFRIRGYLTRHIK
KHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDTYKTHLKARHVLYPKGVKPQDRNKSSG
HCAQCGEYFSTIENFVENHIESGDCKALPQGYTKKNEKRSGKLRKIKTSNGHSRFISTSQ
SVVEPKVLFNKDAVEAMTIVANNSSGNDIISKYGNNKLMLNSENFKVDIPKRKRKYIKKK
QQQVSGSTVTTPEVATQNNQEVAPDEISSATIFSPFDTHLLEPVPSSSSESSAEVMFHGK
QMKNFLIDINSFTNQQQQAQDNPSFLPLDIEQSSYDLSEDAMSYPIISTQSNRDCTQYDN
TKISQILQSQLNPEYLSENHMRETQQYLNFYNDNFGSQF* 
Transcription Factor
Binding site(s)
CGGCTC
CGGCN{6}CGGC
RYRCGGCRC
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator