Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Stp2p
Description Transcription factor, activated by proteolytic processing in response to signals from the SPS sensor system for external amino acids; activates transcription of amino acid permease genes
Aminoacid Sequence
Download FASTA
>YHR006W STP2
MPILSLSSTRNSVLTRIYDYLKALVQQVIVPNVEDDKSSKSTPFEKLEPAKQNHPQKDCC
ATEKDDLVDVSELFPKQNNKQLSLTSKSSVVPCALNLDNLETPFSIKIDNNGAVTTQLNL
DEPILRGPSRGEPAKLQNDLISSPPLEESYINNDQYKALFPSNFLPITPVSSVITPASKK
SIDESPLSDEVQGIADESSETLPYICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNS
ISQELRCHTSGGFSRRDTYKTHLKSRHFTYPEGVKPQDRNKSPGVCTQCGEHFSTSESWV
ENHIEAGSCKGLPEGYSEGIREKKKTSKMKMIKTSDGQTRFISSDESVSEPALQNKNCIE
ATVMQSKERPNDKIIPTKTEKNDFGIGTQWFERKQISRPTQTTQSRGPTEVQNLKEWSII
SPPILSPQNASSVPQEYQSSRYTLHMDSPALSSASSALSPLSGDPITTTETNKSYPLDSE
QSLLEPDKTEEDAINQSKESNMISINEMLQKQMDFELLGENHLKETQDYLALYKKAYGIE
F* 
Transcription Factor
Binding site(s)
CGGCTC
CGGGGTGNNNNNNNCGCACCG
CNCACCNG
gHGCCgH
gHGCCgt
txaxcgGYGCCGYRcVxcxH
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator