Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Stp4p
Description Protein containing a Kruppel-type zinc-finger domain; has similarity to Stp1p, Stp2p, and Stp3p
Aminoacid Sequence
Download FASTA
>YDL048C STP4
MLVSSSFASSIDSVMSHETMSLRRNPPFIDTPEKMPNPTASPNGTIHHLIDPSLPLLSST
TSSSRSTLSSTLNSPPPPPLTTSYSSYNSSACQSITSSPTDNTALAHNSKCYFPHSLSPT
PLSSNSSSHVILPPISSFTNLITVAEREFNGRSNSLHANFTSPVPRTVLDHHRHELTFCN
PNNTTGFKTITPSPPTQHQSILPTAVDNVPRSKSVSSLPVSGFPPLIVKQQQQQQLNSSS
SASALPSIHSPLTNEHTSRYSSSLKDSAKITKQRKKKECPICHNFYANLSTHKSTHLTPE
DRPHKCPICQRGFARNNDLIRHKKRHWKDEFMQIYARESDNNSGADDQDDTARTSANNDS
DDSNDKLAASSSSEETKLLKKNQLKSLYKIKGAFKCPYNSTLINLDMEVYPHKSRSLYFE
PINCHQTGVFSRCDTFKNHLKALHFEYPPKTKKEDRGVVPGKCKHCGLQFPNVDVWLNKH
VGKGCGYSYH* 
Transcription Factor
Binding site(s)
DxxxxttCAGCCGYacBagxg
tgCGCTABc
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator