Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Sum1p
Description Transcriptional repressor required for mitotic repression of middle sporulation-specific genes; also acts as general replication initiation factor; involved in telomere maintenance, chromatin silencing; regulated by pachytene checkpoint
Aminoacid Sequence
Download FASTA
>YDR310C SUM1
MSENTTAPSDNITNEQRLPSGPKDDVDTLALTSAQNQANSLRKLDTDANAKALPSITDIP
VSDDSDIKRQVGSGFGSNPLHIKDSEAFPHSSIEALKEGMDKVTKQCNDLKTALLSKDTS
LTDSVQDLFNSLKVLSHNQSVLENKLDDVMKNQVNTDILVNNLNERLNKLSTMLQNTSKV
NHSNLLIENSSNNTSSQHNTSSSRRGPGRPRKDASTSTMNKLVSNAASVNLKSASNQGAP
FSPVNITLPTAVVQTSKSKRYFVEPSTKQESLLLSAPSSSRDDADMSLTSVPQRTNNENG
KERPSTANSSSITPTPVTPNNLIQIKRKRGRPPKKRTVETMISNSTDTIDKSDASNRIKN
EIPINSLLPSSKFHQIPSSPSNPVSQPAPVRTSRSATQEIDIKSLELASLISTNGDPNAE
DSNTTDTVHNNVEGKVNVEENKTEKEKIITIKSSSENSGNNTTNNNNTDNVIKFSANSDI
NSDIRRLMVNDQFSLSYDASGNITVKLPPVSSPAAATAAAAAAVTSEMNRQQRELDKRRD
SREKMLVNMKYNDRDKAKSFMESNKKLLKAMKEEERRKRMTSIIHDNHLNLNLNEISTRS
KIKSAEKPTTKGSSMSPKPRSASISGISDHQQEGYQPLEQEKLVDIDNEGSNANSDSLKM
GLTISAADTVHKVGIQSMLNSGEEAITKENAEYERKTPGDEETTTFVPLENSQPSDTIRK
RTAGDDGALDQTENTSISPKKRRTEDHTKGEEDEGERGVGNSGTLATVENVSGDISADLS
KGTSSIHNDTESANDSSNGNGNLGLGTESRNTLLTATPIELICREGFFYRRDIPDVPITT
GAYLEFKFKAKEEELINSSINEEDYAAKSKHEKMNAHFFKPDIQEETELAFEILSKTTLT
EKYVNSLEYFLMEFRWENKLVGLGLKLRESKRTWQRRKALFALFEFWRDQSRDKRRFHNY
TILHAVKEMENYRIFINRSVSWFYNHITLLKMILYDLCDNVTTQWREWMFPHNETLPALG
QDGINEDNLNETIDNMLIFDFLDDGSENNQVKYSRIIPPDIR* 
Transcription Factor
Binding site(s)
GNCRCAAAW
aaAAATWtt
HxxaWAWWWWWWTWxtaH
aDtAWWt
DaAWt
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator