Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Swi4p
Description DNA binding component of the SBF complex (Swi4p-Swi6p), a transcriptional activator that in concert with MBF (Mbp1-Swi6p) regulates late G1-specific transcription of targets including cyclins and genes required for DNA synthesis and repair
Aminoacid Sequence
Download FASTA
>YER111C SWI4
MPFDVLISNQKDNTNHQNITPISKSVLLAPHSNHPVIEIATYSETDVYECYIRGFETKIV
MRRTKDDWINITQVFKIAQFSKTKRTKILEKESNDMQHEKVQGGYGRFQGTWIPLDSAKF
LVNKYEIIDPVVNSILTFQFDPNNPPPKRSKNSILRKTSPGTKITSPSSYNKTPRKKNSS
SSTSATTTAANKKGKKNASINQPNPSPLQNLVFQTPQQFQVNSSMNIMNNNDNHTTMNFN
NDTRHNLINNISNNSNQSTIIQQQKSIHENSFNNNYSATQKPLQFFPIPTNLQNKNVALN
NPNNNDSNSYSHNIDNVINSSNNNNNGNNNNLIIVPDGPMQSQQQQQHHHEYLTNNFNHS
MMDSITNGNSKKRRKKLNQSNEQQFYNQQEKIQRHFKLMKQPLLWQSFQNPNDHHNEYCD
SNGSNNNNNTVASNGSSIEVFSSNENDNSMNMSSRSMTPFSAGNTSSQNKLENKMTDQEY
KQTILTILSSERSSDVDQALLATLYPAPKNFNINFEIDDQGHTPLHWATAMANIPLIKML
ITLNANALQCNKLGFNCITKSIFYNNCYKENAFDEIISILKICLITPDVNGRLPFHYLIE
LSVNKSKNPMIIKSYMDSIILSLGQQDYNLLKICLNYQDNIGNTPLHLSALNLNFEVYNR
LVYLGASTDILNLDNESPASIMNKFNTPAGGSNSRNNNTKADRKLARNLPQKNYYQQQQQ
QQQPQNNVKIPKIIKTQHPDKEDSTADVNIAKTDSEVNESQYLHSNQPNSTNMNTIMEDL
SNINSFVTSSVIKDIKSTPSKILENSPILYRRRSQSISDEKEKAKDNENQVEKKKDPLNS
VKTAMPSLESPSSLLPIQMSPLGKYSKPLSQQINKLNTKVSSLQRIMGEEIKNLDNEVVE
TESSISNNKKRLITIAHQIEDAFDSVSNKTPINSISDLQSRIKETSSKLNSEKQNFIQSL
EKSQALKLATIVQDEESKVDMNTNSSSHPEKQEDEEPIPKSTSETSSPKNTKADAKFSNT
VQESYDVNETLRLATELTILQFKRRMTTLKISEAKSKINSSVKLDKYRNLIGITIENIDS
KLDDIEKDLRANA* 
Transcription Factor
Binding site(s)
CACGAAA
TTTTCGCT
tTTCGCGt
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator