Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Tea1p
Description Ty1 enhancer activator required for full levels of Ty enhancer-mediated transcription; C6 zinc cluster DNA-binding protein
Aminoacid Sequence
Download FASTA
>YOR337W TEA1
MTAPLWPNKNEKNHTVKRALSTDMTSNILSSTNASSNEENSRSSSAANVRSGTGANTLTN
GGSTRKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDEDLRKKRYTNKYVKSLESHI
AQLETNLKNLVQKIYPDDEQILNRMMVGDVLSALPDSSQVSINYTDQTPSLPIPATRGTF
IIENDKVSQPLSSFNQQTEPSTLNSGIFNTQKQNFEESLDDQLLLRRSLTPQGEKKKKPL
VKGSLYPEGPVSYKRKHPVKSDSLLPVSSLTAATDPSTFSDGITAGNSVLVNGELKKRIS
DLKTTVIVRGLNDDNPNSINNDPRILKSLSNFYKWLYPGYFIFVHRESFLYGFFNHSKNN
YEDSSYCSVELIYAMCAVGSRLTPDLQEYSEVYYQRSKKTLLQLVFDEQSTARITTVQAL
FCLAFYELGKGNNQLGWYFSGLAIRVGYDMGFQLDPKVWYVDDNNLQLTQSELEIRSRIY
WGCYIADHFICLMLGRTSTLSVSNSTMPESDELPEVNGTEEFRFIGRHVLQISLPLKNLI
ILSRLVQIFTSKIFIESEDIARKLKYLNTFNSQVYNWRQSLPEFLQWSKTLIENDDVSTD
PTISYFWYCYYIVRLTFNKPFIEDSQESETVVIEIIDDLKTLLDNFGKKFGNYTKGNLYQ
LYSCLLAINCLKKLKEIRSSEQDSWNAQLDFFNHIFYTQLYPAYDLPKKLQEDTELETEQ
ENQMLNQVGNINYTHDFSLSHEIDDLIRELFGVGTPQKL* 
Transcription Factor
Binding site(s)
CGGN{10}CCG
GCGSRCWt
CGSxxxtxxa
DtcTgCGGaAaTTAAWtAcC
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator