Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Tec1p
Description Transcription factor required for full Ty1 expression, Ty1-mediated gene activation, and haploid invasive and diploid pseudohyphal growth; TEA/ATTS DNA-binding domain family member
Aminoacid Sequence
Download FASTA
>YBR083W TEC1
MSLKEDDFGKDNSRNIESYTGRIFDVYIQKDSYSQSALDDMFPEAVVSTAACVKNEAEDN
INLIDTHPQFELVNTGLGAKSDDLKSPSAKATFTDKQRKNEVPNISVSNYFPGQSSETSS
TTESWTIGCDKWSEKVEEAFLEALRLIMKNGTTKIKIRNANFGRNELISLYIKHKTNEFR
TKKQISSHIQVWKKTIQNKIKDSLTLSSKEKELLHLIEHGAEQTTENSNLFYDIFEEIID
SLPSVSDSGSLTPKNLYVSNNSSGLSVHSKLLTPITASNEKKIENFIKTNAASQAKTPLI
YAKHIYENIDGYKCVPSKRPLEQLSPTELHQGDRPNKASFSNKKAILESAKKIEIEQRKI
INKYQRISRIQEHESNPEFSSNSNSGSEYESEEEVVPRSATVTQLQSRPVPYYKNNGMPY
SLSKVRGRPMYPRPAEDAYNANYIQGLPQYQTSYFSQLLLSSPQHYEHSPHQRNFTPSNQ
SHGNFY* 
Transcription Factor
Binding site(s)
TTCTCACATTCTTC
CATTCT
CATTCC
CATTCTT
RMATTCYY
tcRRGAATGTtgxt
VRGAATgt
gRGAATGY
ACATTCTTACATTCTT
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator