Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Tod6p
Description PAC motif binding protein involved in rRNA and ribosome biogenesis; subunit of the RPD3L histone deacetylase complex; Myb-like HTH transcription factor, similar to Dot6p; hypophosphorylated by rapamycin treatment in a Sch9p-dependent manne
Aminoacid Sequence
Download FASTA
>YBL054W TOD6
MWGILLKSSNKSCSRLWKPILTQYYSMTSTATDSPLKYYDIGLNLTDPMFHGIYNGKQYH
PADYVKLLERAAQRHVKNALVTGSSIAESQSAIELVSSVKDLSPLKLYHTIGVHPCCVNE
FADASQGDKASASIDNPSMDEAYNESLYAKVISNPSFAQGKLKELYDLMNQQAKPHDTSF
RSIGEIGLDYDRFHYSSKEMQKVFFEEQLKISCLNDKLSSYPLFLHMRSACDDFVQILER
FIAGFTDERDTFQLQKLGASSSSGFYKFHPDRKLVVHSFTGSAIDLQKLLNLSPNIFIGV
NGCSLRTEENLAVVKQIPTERLLLETDAPWCEIKRTHASFQYLAKYQEVRDFEYPAFKSV
KKNKLADKLNAEELYMVKGRNEPCNMEQVAIVVSEVKDVDLATLIDTTWKTTCKIFGE* 
Transcription Factor
Binding site(s)
aDcgCGATGAGStxHxV
cGATG
CGATGSSc
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator