Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Tog1p
Description Putative zinc cluster protein; deletion confers sensitivity to Calcufluor white, and prevents growth on glycerol or lactate as sole carbon source
Aminoacid Sequence
Download FASTA
>TOG1 YER184C
MAAKRGLAKQKSRVTKACDRCHRKKIKCNSKKPCFGCIGSQSKCTYRNQFREPIEAFFNY
TGSLSNDLDNAKCSIAKLKAQLPPSAPASLQKGLANICTELEKIQPQLYLNLDSKEISSY
GGLKSIETEIIGKQSKSLNRFSNAFESNTAQNVSMYFGVYSPLLYFASTGISWITKKLIS
CSNDRETRETIYLFLKFLDASSASHAGPKVTSISPLEYYSKLNGLSCGNDVLIQHIMSNI
SNEIKGNTNINQTIKFNKPTDWFMYGVQLMEQHHKALDRKSSKKLLPLKYFLEQDELIFC
LCLEYFERSLFSTMYDLTILKGLVSLMKHRYWIDDPFVLGRIISTMSRRSLDAGLNRWEY
YIGQDEDTAEEYRKLWWDCYWWDRWYSLVTGKQPLIPHEMTSCLFPKDVVGLGVDDSMDC
FTLINLVELDPSKFDICISFGYILLTKIITAVFSGLLYNRHFTDYRLFATPNAKDLNGTA
RQLMVEFSKICKIFQCIQDKLIPFLKQYSENSNVFELYTHFGFAKVCCFQGMESLILRIQ
NLLQERERIELDSCVKDIRLQTFEASVDILTDVLKHEDTFYIFRCSWFIYAILMNITLNF
IETPRRNSICYLSLMCRMIASYNDLFVSSGNVNFKGNNAFSKKLENGTAVSFILTRICCQ
MYTRSQKMAKESLFCELKKYGQACSDAGQAALDIECIWYRNIIGEHKESSFRKEILSILD
REMGDLVNNRVIGVQGKNQEGACYEKLSPSSTSVSVGMDFCSLENFVTAESLPDLLNLFW
EDTEFGITKENLGE* 
Transcription Factor
Binding site(s)
acCGGCCGg
HtCCGGMa
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator