Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Tog1p
Description Putative zinc cluster protein; deletion confers sensitivity to Calcufluor white, and prevents growth on glycerol or lactate as sole carbon source
Aminoacid Sequence
Download FASTA
>TOG1 YER184C
MAAKRGLAKQKSRVTKACDRCHRKKIKCNSKKPCFGCIGSQSKCTYRNQFREPIEAFFNY
TGSLSNDLDNAKCSIAKLKAQLPPSAPASLQKGLANICTELEKIQPQLYLNLDSKEISSY
GGLKSIETEIIGKQSKSLNRFSNAFESNTAQNVSMYFGVYSPLLYFASTGISWITKKLIS
CSNDRETRETIYLFLKFLDASSASHAGPKVTSISPLEYYSKLNGLSCGNDVLIQHIMSNI
SNEIKGNTNINQTIKFNKPTDWFMYGVQLMEQHHKALDRKSSKKLLPLKYFLEQDELIFC
LCLEYFERSLFSTMYDLTILKGLVSLMKHRYWIDDPFVLGRIISTMSRRSLDAGLNRWEY
YIGQDEDTAEEYRKLWWDCYWWDRWYSLVTGKQPLIPHEMTSCLFPKDVVGLGVDDSMDC
FTLINLVELDPSKFDICISFGYILLTKIITAVFSGLLYNRHFTDYRLFATPNAKDLNGTA
RQLMVEFSKICKIFQCIQDKLIPFLKQYSENSNVFELYTHFGFAKVCCFQGMESLILRIQ
NLLQERERIELDSCVKDIRLQTFEASVDILTDVLKHEDTFYIFRCSWFIYAILMNITLNF
IETPRRNSICYLSLMCRMIASYNDLFVSSGNVNFKGNNAFSKKLENGTAVSFILTRICCQ
MYTRSQKMAKESLFCELKKYGQACSDAGQAALDIECIWYRNIIGEHKESSFRKEILSILD
REMGDLVNNRVIGVQGKNQEGACYEKLSPSSTSVSVGMDFCSLENFVTAESLPDLLNLFW
EDTEFGITKENLGE* 
Transcription Factor
Binding site(s)
acCGGCCGg
HtCCGGMa
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
External source Open in SGD external link
w3c xhtml validator w3c css validator