Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Ume6p
Description Key transcriptional regulator of early meiotic genes, binds URS1 upstream regulatory sequence, couples metabolic responses to nutritional cues with initiation and progression of meiosis, forms complex with Ime1p, and also with Sin3p-Rpd3p
Aminoacid Sequence
Download FASTA
>YDR207C UME6
MLDKARSQSKHMDESNAAASLLSMETTANNHHYLHNKTSRATLMNSSQDGKKHAEDEVSD
GANSRHPTISSASIESLKTTYDENPLLSIMKSTCAPNNTPVHTPSGSPSLKVQSGGDIKD
DPKENDTTTTTNTTLQDRRDSDNAVHAAASPLAPSNTPSDPKSLCNGHVAQATDPQISGA
IQPQYTATNEDVFPYSSTSTNSNTATTTIVAGAKKKIHLPPPQAPAVSSPGTTAAGSGAG
TGSGIRSRTGSDLPLIITSANKNNGKTTNSPMSILSRNNSTNNNDNNSIQSSDSRESSNN
NEIGGYLRGGTKRGGSPSNDSQVQHNVHDDQCAVGVAPRNFYFNKDREITDPNVKLDENE
SKINISFWLNSKYRDEAYSLNESSSNNASSNTDTPTNSRHANTSSSITSRNNFQHFRFNQ
IPSQPPTSASSFTSTNNNNPQRNNINRGEDPFATSSRPSTGFFYGDLPNRNNRNSPFHTN
EQYIPPPPPKYINSKLDGLRSRLLLGPNSASSSTKLDDDLGTAAAVLSNMRSSPYRTHDK
PISNVNDMNNTNALGVPASRPHSSSFPSKGVLRPILLRIHNSEQQPIFESNNSTAVFDED
QDQNQDLSPYHLNLNSKKVLDPTFESRTRQVTWNKNGKRIDRRLSAPEQQQQLEVPPLKK
SRRSVGNARVASQTNSDYNSLGESSTSSAPSSPSLKASSGLAYTADYPNATSPDFAKSKG
KNVKPKAKSKAKQSSKKRPNNTTSKSKANNSQESNNATSSTSQGTRSRTGCWICRLRKKK
CTEERPHCFNCERLKLDCHYDAFKPDFVSDPKKKQMKLEEIKKKTKEAKRRAMKKK* 
Transcription Factor
Binding site(s)
TAGCCGCCGA
tagcCGCB
tWRCCGCgg
tWxcCGCB
txxaDaTWGCCGCcgaxaa
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator