Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Upc2p
Description Sterol regulatory element binding protein, induces transcription of sterol biosynthetic genes and of DAN/TIR gene products; Ecm22p homolog; relocates from intracellular membranes to perinuclear foci on sterol depletion
Aminoacid Sequence
Download FASTA
>YDR213W UPC2
MSEVGIQNHKKAVTKPRRREKVIELIEVDGKKVSTTSTGKRKFHNKSKNGCDNCKRRRVK
CDEGKPACRKCTNMKLECQYTPIHLRKGRGATVVKYVTRKADGSVESDSSVDLPPTIKKE
QTPFNDIQSAVKASGSSNDSFPSSASTTKSESEEKSSAPIEDKNNMTPLSMGLQGTINKK
DMMNNFFSQNGTIGFGSPERLNSGIDGLLLPPLPSGNMGAFQLQQQQQVQQQSQPQTQAQ
QASGTPNERYGSFDLAGSPALQSTGMSLSNSLSGMLLCNRIPSGQNYTQQQLQYQLHQQL
QLQQHQQVQLQQYQQLRQEQHQQVQQQQQEQLQQYQQHFLQQQQQVLLQQEQQPNDEEGG
VQEENSKKVKEGPLQSQTSETTLNSDAATLQADALSQLSKMGLSLKSLSTFPTAGIGGVS
YDFQELLGIKFPINNGNSRATKASNAEEALANMQEHHERAAASVKENDGQLSDTKSPAPS
NNAQGGSASIMEPQAADAVSTMAPISMIERNMNRNSNISPSTPSAVLNDRQEMQDSISSL
GNLTKAALENNEPTISLQTSQTENEDDASRQDMTSKINNEADRSSVSAGTSNIAKLLDLS
TKGNLNLIDMKLFHHYCTKVWPTITAAKVSGPEIWRDYIPELAFDYPFLMHALLAFSATH
LSRTETGLEQYVSSHRLDALRLLREAVLEISENNTDALVASALILIMDSLANASGNGTVG
NQSLNSMSPSAWIFHVKGAATILTAVWPLSERSKFHNIISVDLSDLGDVINPDVGTITEL
VCFDESIADLYPVGLDSPYLITLAYLDKLHREKNQGDFILRVFTFPALLDKTFLALLMTG
DLGAMRIMRSYYKLLRGFATEVKDKVWFLEGVTQVLPQDVDEYSGGGGMHMMLDFLGGGL
PSMTTTNFSDFSL* 
Transcription Factor
Binding site(s)
TCGTATA
TATACGA
TCGTTYAG
TCGTWCC
TCGTWta
cTCGTWTAg
TAAACGA
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator