Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Upc2p
Description Sterol regulatory element binding protein, induces transcription of sterol biosynthetic genes and of DAN/TIR gene products; Ecm22p homolog; relocates from intracellular membranes to perinuclear foci on sterol depletion
Aminoacid Sequence
Download FASTA
>YDR213W UPC2
MSEVGIQNHKKAVTKPRRREKVIELIEVDGKKVSTTSTGKRKFHNKSKNGCDNCKRRRVK
CDEGKPACRKCTNMKLECQYTPIHLRKGRGATVVKYVTRKADGSVESDSSVDLPPTIKKE
QTPFNDIQSAVKASGSSNDSFPSSASTTKSESEEKSSAPIEDKNNMTPLSMGLQGTINKK
DMMNNFFSQNGTIGFGSPERLNSGIDGLLLPPLPSGNMGAFQLQQQQQVQQQSQPQTQAQ
QASGTPNERYGSFDLAGSPALQSTGMSLSNSLSGMLLCNRIPSGQNYTQQQLQYQLHQQL
QLQQHQQVQLQQYQQLRQEQHQQVQQQQQEQLQQYQQHFLQQQQQVLLQQEQQPNDEEGG
VQEENSKKVKEGPLQSQTSETTLNSDAATLQADALSQLSKMGLSLKSLSTFPTAGIGGVS
YDFQELLGIKFPINNGNSRATKASNAEEALANMQEHHERAAASVKENDGQLSDTKSPAPS
NNAQGGSASIMEPQAADAVSTMAPISMIERNMNRNSNISPSTPSAVLNDRQEMQDSISSL
GNLTKAALENNEPTISLQTSQTENEDDASRQDMTSKINNEADRSSVSAGTSNIAKLLDLS
TKGNLNLIDMKLFHHYCTKVWPTITAAKVSGPEIWRDYIPELAFDYPFLMHALLAFSATH
LSRTETGLEQYVSSHRLDALRLLREAVLEISENNTDALVASALILIMDSLANASGNGTVG
NQSLNSMSPSAWIFHVKGAATILTAVWPLSERSKFHNIISVDLSDLGDVINPDVGTITEL
VCFDESIADLYPVGLDSPYLITLAYLDKLHREKNQGDFILRVFTFPALLDKTFLALLMTG
DLGAMRIMRSYYKLLRGFATEVKDKVWFLEGVTQVLPQDVDEYSGGGGMHMMLDFLGGGL
PSMTTTNFSDFSL* 
Transcription Factor
Binding site(s)
TCGTATA
TCGTTYAG
TCGTWCC
TCGTWta
cTCGTWTAg
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator