Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Urc2p
Description Putative Zn(II)2Cys6 motif containing transcription factor; non-essential gene identified in a screen for mutants with increased levels of rDNA transcription; similar to S. kluyveri Urc2p involved in uracil catabolism
Aminoacid Sequence
Download FASTA
>YDR520C URC2
MDINSNASVSPRPDGLPMTAGYNSASGKVRNSIRSIINHPEDSARAKERSETNSPKNNGN
KKPRKKRKTFSCDTCRRVKTRCDFEPFIGKCYRCNVLQLDCSLARNKDNEILNTLREDGL
LKKINSINHNLGSFSHLNADSPNESQSSFEKNGTVNFDNYMIDKRLSSLEEHIKSLHQKM
DLIITTAKMSYNSDIKGPGDDIQNVDFSSNKTYDSRLTSGSETIRKTGEYRKENLFLNGF
KLKESPLKLLHDIDERLFPSKATSKAAKLAGQQRPYAVARVNFLHFYENNQELCHKLAKE
FLVRSHFWIIPGGRKEIDVEYAHSHLFITSVFTIIAMSFADNDKYAAEQEILYPLVERLL
TNTLTMFEKLTAFDIEAILYCCMFHISRKAKRYRQLKFNSLVLSNFALNSLLHVIDFYQI
KDRVLVKEVYNPEDLYHLRILNSLTACYLEYSISYGDIREQDDMLKEFNKLVAKFPQANF
GDDIKISEINLGDIVNGIFINLKNYFAQCLDDFNNDRYGGNADTFIFVFPELNYWLKNWE
ELLAKDGAGVLLFTFDFYHIMICRTFITEFSSTLKSNQRFLKLILNTMKEHSFSLLNGFL
RLPPTLIRGAPIFTCHQLVYACLTLCDYLYWFDSSERQRVLSLCTKVYWHLSTIGEKMNE
ATDNVGKIIKSIIDTSKTRINFGSLSKENSDNDKMSTNANNYTGAGNLHAAKPATSPTNV
GTLHENLSSSHFMIPDVDQFNSFEDFFQDFFDSLKPNSQKMFTSDKKTEQTT* 
Transcription Factor
Binding site(s)
cggaxata
HCGGagWTA
cxtCGGAGATAWtt
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator