Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Vhr1p
Description Transcriptional activator, required for the vitamin H-responsive element (VHRE) mediated induction of VHT1 (Vitamin H transporter) and BIO5 (biotin biosynthesis intermediate transporter) in response to low biotin concentrations
Aminoacid Sequence
Download FASTA
>YIL056W VHR1
MNGPPTFTQYRINKFSGNGATHKIRELLNFNDEKKWKQFSSRRLELIDKFQLSQYKASEQ
DQNIKQIATILRTEFGYPVSCSKEFEKLVTAAVQSVRRNRKRSKKRYALSIANGSGGNVN
NSISSNSTSDDEISPSIYQRSNSDFLPSSNYAADFQFSNKFQPLMSHQSHNGTIFPTVGT
QNDSSPSVTSTQQKYNDIVTMLVHDLVTNVVPLSEQALKDPYTGPNLSHFATSSLSQQPN
ITTNIPIDSTVPFFLREKLLLQIQRSRTCQDISQAAGSIDIYANLEILGEMSIRMSIAFV
IERFFSNLVSSSMKYITAKTCSPENLALLSQRLFGAATRHNLSHFPAAQVQLRLLYLVIG
GIVKDFGFDPTLYPLSEIIHHIVMVQYPLASSCASEPPSSSPNKRVKRSPPVVSSDVMLN
NNNTLSNRATLLTTLPMKPQSANKDVNRRVIIRFNDREQAFTFHQLSNGPPTVSEVLENC
KNLFNIINKNKNFGIFHNDNLLNDESLAKLFDSFSTSEIHLVIKDISTIPLQDAKIPVPI
TLPKMSCIGENPSMPSIPLVPQEKDDPKKSSLTAFDNILNRISKSPMNEENSNTTLNTGT
STSNTNNNDHNESVPAPYVTKNKNSFQNGNLPQPVFQPLL* 
Transcription Factor
Binding site(s)
gRTGASTCAc
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator