Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Xbp1p
Description Transcriptional repressor that binds to promoter sequences of the cyclin genes, CYS3, and SMF2; expression is induced by stress or starvation during mitosis, and late in meiosis; member of the Swi4p/Mbp1p family; potential Cdc28p substrate
Aminoacid Sequence
Download FASTA
>YIL101C XBP1
MKYPAFSINSDTVHLTDNPLDDYQRLYLVSVLDRDSPPASFSAGLNIRKVNYKSSIAAQF
THPNFIISARDAGNGEEAAAQNVLNCFEYQFPNLQTIQSLVHEQTLLSQLASSATPHSAL
HLHDKNILMGKIILPSRSNKTPVSASPTKQEKKALSTASRENATSSLTKNQQFKLTKMDH
NLINDKLINPNNCVIWSHDSGYVFMTGIWRLYQDVMKGLINLPRGDSVSTSQQQFFCKAE
FEKILSFCFYNHSSFTSEESSSVLLSSSTSSPPKRRTSTGSTFLDANASSSSTSSTQANN
YIDFHWNNIKPELRDLICQSYKDFLINELGPDQIDLPNLNPANFTKRIRGGYIKIQGTWL
PMEISRLLCLRFCFPIRYFLVPIFGPDFPKDCESWYLAHQNVTFASSTTGAGAATAATAA
ANTSTNFTSTAVARPRQKPRPRPRQRSTSMSHSKAQKLVIEDALPSFDSFVENLGLSSND
KNFIKKNSKRQKSSTYTSQTSSPIGPRDPTVQILSNLASFYNTHGHRYSYPGNIYIPQQR
YSLPPPNQLSSPQRQLNYTYDHIHPVPSQYQSPRHYNVPSSPIAPAPPTFPQPYGDDHYH
FLKYASEVYKQQNQRPAHNTNTNMDTSFSPRANNSLNNFKFKTNSKQ* 
Transcription Factor
Binding site(s)
CTCGA
tcxxxYYTCGARRxatgxg
cTCGAR
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator