Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Eds1p
Description Putative zinc cluster protein; YBR033W is not an essential gene
Aminoacid Sequence
Download FASTA
>EDS1 YBR033W
MSHHVPNLYGTPIRDPHERKRNSASMGEVNQSVSSRNCERGSEKGTKQRKKASHACDQCR
RKRIKCRFDKHTGVCQGCLEVGEKCQFIRVPLKRGPAKKRGSVVSIEKFSSDNDPLQYRP
RTHSYPMNSGNNYLPSLARNSSFPSISSLFVPSITAQSQQFVKVPYDDIKRRSSLAILGS
DSSISTEFGGNYRLDENLNVRQEGKDIVAKGMITPVEEMGACSSNVRRQGSQSLPIQEQR
ASPYINPFISGRSRLSSLSYTSEATTSEGNTQGKNQCMLTPNSVRSIEKERLNSLTAGFP
NKKLGTDGRSDKWDKNSTWKPVYRSSNPSHPSTEKNVSLNQEASAKPLMLGTYRQFDATS
FYKVLGIYYNFFHINFPVIPINKSKFTDMLDPEKPNVIDEIRQINNEIIQCFKTALEVLV
FCKIKQRRSSKSTKSWSRDSLCDFQKGLYYIQNFNKCIADCFQSLITIKPVLKQNSSVIP
SRIKFIYFSTIIVLNFILILAGEESSLLLGPSVGVFNEFQAHKLFLPFQNTSPMLLLNSN
EESGDEILDYAVLFKRLYILLNILDTLQSFRLGQPKLINLNFGSAIETYFSDKTGHNQVV
EKAPVALDNILRNLKLGEFITYFVLNRKSLQVNVPHHLLFTNQTDYGEFAVEKGEHDNIA
GKFETLLKKKEILIRKLLNIEQKNDHILENCCNSDAEMKNIGELVCSMITLVSGILDSIT
NMNAENSVDLDSKPLPNAYFAQDSEEELMSPTQSITSNLASEENTRCTTKDLMGTVSIFM
LPMVEECYNIISLIGPIPTTLISLYIRNGNMAKGINDRIMTLSTALNELVQITALFNTLE
PFRKNAHDRAKRYYVSATSSTGCYESVMKSMYSGKCAASNASNVAPSEEENKKILKKFAD
IGWKLMDDSELGCCCCFFN* 
Transcription Factor
Binding site(s)
cCGGAWaAWYt
cGGAAaAAt
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
External source Open in SGD external link
w3c xhtml validator w3c css validator