Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YBR239c
Description Transcriptional regulator of nonfermentable carbon utilization; GFP-fusion protein localizes to cytoplasm, nucleus; null mutation affects periodicity of transcriptional and metabolic oscillation; plays role in restricting Ty1 transposition
Aminoacid Sequence
Download FASTA
MCTPDENDYKTSTDPDTSANTNHTLEKKKRKKRKNTNVACVNCSRLHVSCEAKRPCLRCI
SKGLTATCVDAPRKKSKYLAGIPNRELPMNIQPDLPPRKIMIPIYNNSSNSSLNVNNMGE
QQKFTSPQHIVHKAKFLSNAADSEYSILSNIIYQDTLSNKIPIDILYSNTNSTSNSTIGN
SSNNSPTGTNTSPEETEMEKIRQLYSEQRANIPPHPYPSSNQNVYSILLGPNSAKIVASQ
VNLFANHFPLVPVDSADNSLNFKRLLPRDPSEKSSQINWDSSINQYYLNSETVTFPELAI
PLKRRKNHLVSVSLESCSPDAANIKSNVEWEHSLRYSTPMEIYTSINAPFSHTPGFHHLL
VYLKHRFNQQDLVKMCRSIAEFRPIFIACSVTLTEEDMIFMEQCYQRTLLEYVKFIAQIG
TPTCIWRRNGQISYVNEEFEILCGWTREELLNKMTFIVEIMDDESVRDYFKTLSKVAYRD
FRGSEKMKVCRLLSPIKGKIIHCCCMWTLKRDVSGLPLMILGNFMPILN* 
Transcription Factor
Binding site(s)
CGGaa
aYCGGAAc
axxTTCCGGAAC
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator