Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YBR267w
Description Cytoplasmic pre-60S factor; required for the correct recycling of shuttling factors Alb1, Arx1 and Tif6 at the end of the ribosomal large subunit biogenesis; involved in bud growth in the mitotic signaling network
Aminoacid Sequence
Download FASTA
>YBR267W  Chr 2  
MSSSGVYTCNSCVLTFDSSDEQRAHMKSDWHRYNLKRRVAQLPPISFETFDSKVSAAAAS
TSKSAEKEKPVTKKELKRREKQALLEKKKKLLEIARANMLENMQKSQEGNTPDLSKLSLQ
ENEENKEKEEPKKEEPEQLTEEEMAERVMQENVRNRVDIPLEQCLFCEHNKHFKDVEENL
EHMFRTHGFYIPEQKYLVDKIGLVKYMSEKIGLGNICIVCNYQGRTLTAVRQHMLAKRHC
KIPYESEDERLEISEFYDFTSSYANFNSNTTPDNEDDWEDVGSDEAGSDDEDLPQEYLYN
DGIELHLPTGIKVGHRSLQRYYKQDLKPEVILTEGQGTLVAAETRSFLPAFDKKGVQTQQ
RVWQTERFDKKRLDKRSAKFVNNQPHYRDQLLQ* 
Transcription Factor
Binding site(s)
tcAGGgg
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator