Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YDR520c
Description Putative Zn(II)2Cys6 motif containing transcription factor; non-essential gene identified in a screen for mutants with increased levels of rDNA transcription; similar to S. kluyveri Urc2p involved in uracil catabolism
Aminoacid Sequence
Download FASTA
MDINSNASVSPRPDGLPMTAGYNSASGKVRNSIRSIINHPEDSARAKERSETNSPKNNGN
KKPRKKRKTFSCDTCRRVKTRCDFEPFIGKCYRCNVLQLDCSLARNKDNEILNTLREDGL
LKKINSINHNLGSFSHLNADSPNESQSSFEKNGTVNFDNYMIDKRLSSLEEHIKSLHQKM
DLIITTAKMSYNSDIKGPGDDIQNVDFSSNKTYDSRLTSGSETIRKTGEYRKENLFLNGF
KLKESPLKLLHDIDERLFPSKATSKAAKLAGQQRPYAVARVNFLHFYENNQELCHKLAKE
FLVRSHFWIIPGGRKEIDVEYAHSHLFITSVFTIIAMSFADNDKYAAEQEILYPLVERLL
TNTLTMFEKLTAFDIEAILYCCMFHISRKAKRYRQLKFNSLVLSNFALNSLLHVIDFYQI
KDRVLVKEVYNPEDLYHLRILNSLTACYLEYSISYGDIREQDDMLKEFNKLVAKFPQANF
GDDIKISEINLGDIVNGIFINLKNYFAQCLDDFNNDRYGGNADTFIFVFPELNYWLKNWE
ELLAKDGAGVLLFTFDFYHIMICRTFITEFSSTLKSNQRFLKLILNTMKEHSFSLLNGFL
RLPPTLIRGAPIFTCHQLVYACLTLCDYLYWFDSSERQRVLSLCTKVYWHLSTIGEKMNE
ATDNVGKIIKSIIDTSKTRINFGSLSKENSDNDKMSTNANNYTGAGNLHAAKPATSPTNV
GTLHENLSSSHFMIPDVDQFNSFEDFFQDFFDSLKPNSQKMFTSDKKTEQTT* 
Transcription Factor
Binding site(s)
cggaxata
HCGGagWTA
cxtCGGAGATAWtt
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator