Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Vhr2p
Description Non-essential nuclear protein; null mutation has global effects on transcription
Aminoacid Sequence
Download FASTA
>YER064C YER064C
MIDDTENSKIHLEGSHKTGKYTGYGTTHKIRAQLNFNDEKKWKKFSSRRLELIDSFGLSQ
HKASEQDDNIRQIATILRSEFEYPDTFSAEFEKLVTAAVQSVRRNRKRSKKKLLDSKKKI
ARGKVQKIPLSPPSSSNMGSCSASNASSSDEEASVKEEPAEHALPSLNTITSQKLLPYPN
GRTLPPVPTQVRSLLKKNASLLRDPSAPYAHGGDEKLQKFDIEDQPLESEQEYDFIAKSI
IVEIVNNAIPLPEQIQRDKFIRPNLTKKKGCQSKVVISNNLRKLILSKIHNSRTCLEMSK
DERNLDSFANLETLGKNSLMASISLVVENSFSHLPSSTKQYLTERLSSIEFLTILSQRLF
MPATRQLFADLSQEKIQVRVLNLILGSLVKDYGFDASLAPINEIIYHMTLHQYPLVCSNK
QSNPMRPHSTSEVLSAHSSTKDASTPGKEEPRVTRSSTSADSTIITLPSIEVPNTYDDDR
LKMLSAISLQIENSTFSKPFSTISK* 
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator