Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YER130c
Description Protein of unknown function; transcription is regulated by Haa1p, Sok2p and Zap1p transcriptional activators; the C. Albicans homolog (MNL1) plays a role in adaptation to stress
Aminoacid Sequence
Download FASTA
>YER130C YER130C
MSLYPLQRFESNDTVFSYTLNSKTELFNESRNNDKQHFTLQLIPNANANAKEIDNNNVEI
INDLTGNTIVDNCVTTATSSNQLERRLSISDYRTENGNYYEYEFFGRRELNEPLFNNDIV
ENDDDIDLNNESDVLMVSDDELEVNERFSFLKQQPLDGLNRISSTNNLKNLEIHEFIIDP
TENIDDELEDSFTTVPQSKKKVRDYFKLNIFGSSSSSNNNSNSLGCEPIQTENSSSQKMF
KNRFFRSRKSTLIKSLPLEQENEVLINSGFDVSSNEESDESDHAIINPLKLVGNNKDIST
QSIAKTTNPFKSGSDFKMIEPVSKFSNDSRKDLLAAISEPSSSPSPSAPSPSVQSSSSSH
GLVVRKKTGSMQKTRGRKPSLIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTC
HICNKNFSRSDNLNQHVKTHASL* 
Transcription Factor
Binding site(s)
AGGGG
gRDDVBgg
DAWAGGGG
aaATAGGGGBag
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator