Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YER130c
Description Protein of unknown function; transcription is regulated by Haa1p, Sok2p and Zap1p transcriptional activators; the C. Albicans homolog (MNL1) plays a role in adaptation to stress
Aminoacid Sequence
Download FASTA
>YER130C YER130C
MSLYPLQRFESNDTVFSYTLNSKTELFNESRNNDKQHFTLQLIPNANANAKEIDNNNVEI
INDLTGNTIVDNCVTTATSSNQLERRLSISDYRTENGNYYEYEFFGRRELNEPLFNNDIV
ENDDDIDLNNESDVLMVSDDELEVNERFSFLKQQPLDGLNRISSTNNLKNLEIHEFIIDP
TENIDDELEDSFTTVPQSKKKVRDYFKLNIFGSSSSSNNNSNSLGCEPIQTENSSSQKMF
KNRFFRSRKSTLIKSLPLEQENEVLINSGFDVSSNEESDESDHAIINPLKLVGNNKDIST
QSIAKTTNPFKSGSDFKMIEPVSKFSNDSRKDLLAAISEPSSSPSPSAPSPSVQSSSSSH
GLVVRKKTGSMQKTRGRKPSLIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTC
HICNKNFSRSDNLNQHVKTHASL* 
Transcription Factor
Binding site(s)
AGGGG
gRDDVBgg
DAWAGGGG
aaATAGGGGBag
TCAGGGGT
AATAGGAG
ATAGGGG
ATAGGAG
ATAGGGT
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator