Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YFL052w
Description Putative zinc cluster protein that contains a DNA binding domain; null mutant sensitive to calcofluor white, low osmolarity and heat, suggesting a role for YFL052Wp in cell wall integrity
Aminoacid Sequence
Download FASTA
>YFL052W YFL052W
MARNRQACDCCCIRRVKCDRKKPCKCCLQHNLQCTYLRPLKKRGPKPVKVRNLKKVDDVQ
VFSKSSSGGIMKVPKALIDQCLRLYNDKLYVIWPLLCYDDLYELLEKRYDETCVYWFLVS
LSAATLSDLQTEIESEGGVTFTGIQLSSFCMSSRQEFDDFNGSDIFKIMTYYCLNRCYAQ
MSNSRTSYRLSCEAVGLIKLAGFHREETLKLLPFDEQQLGRKVYYLLLLTERYFSVYTHC
ATSLDTTIAPPQPENVTDPRLSLDSFLEMIRVFTVPGKCFFDALATDSANVTCTEDSLKK
IWRELHTVPLEIEPWSYGYVDISFSRHWIRTLAWKLVLQISGMRISFLSNSKNTHIPVEI
ARDMLEDTFLIPKNLYAVHGPGISVKALEIADALVDVVNQYDQNAESEAWNFLFDISKFV
FSLKHCDSTLVDKFTTKCQCALITLPLSNPLESTDGSKEDVDALP* 
Transcription Factor
Binding site(s)
CGGN{9}CGG
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator