Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YGR067c
Description Putative protein of unknown function; contains a zinc finger motif similar to that of Adr1p
Aminoacid Sequence
Download FASTA
>YGR067C YGR067C
MAAGQKKYICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVHR
TFLLSSYASMTGDKADIPVSLGVGDVDSTSPRDIKMETLVNSMIKVNSGLINIHYHSSNV
EKMDKQQRCVIGKESSSLKKGKSRFKQVKSRLESSISVKILQEYSLDFISSRDILTFFRM
GVSHLVENKIFQNFFPDLFSSLQNDELVESFWINKPFGLIIACLGMSISLNQDSQKLWFI
CCTNLYASSSKHDNDFDTEDILSQTEQHDVFALILFYSLLVMLENNIPVSNSIKKFDVFS
MLQDILKPFTVASSSYHYLNSKENAWFIFDLWVNILRDSNNFNNDSLLIFGWFVNQEFIS
SNPLKDFIYKGPSMSTTDLTLKHINILADSAYVYFIIKKTYPQELPSDFRVHDLLVYLNE
CFVMQQPIKPETSANPSLFANVMNARITDCKSKSNWLLWETIWFEFINNLTLRNGTTRNI
WFIDNFPQVSTSCLLHHSSSFVDETLITTNLSIISMLLNLKSFTLASLNPRNIQLITDIV
SFQLKLFSSELIASSDVSPSQVSQLLVNPNVHLMLYFWFDTIYVQRQSYLSSTEKEEFEK
VEVFVNDYIITHQKNLVTDLHSILFDFWSDSFIAYHILLHAIVSSLRDNILYPYLIYSPH
LNDQTKALLTDISNWSCFALQQPFRKTSRGSLSGASDMKSFSVASCLPLSPNFLKRDSNC
NKILLPPLDIKAIEPISTSNYTYVNSAPKQQEKEQPLLRATGNNINLVQTIVVPPQVNME
SQEFSASSTDNKQSKNIEIFSQIK* 
Transcription Factor
Binding site(s)
gHGGGg
BggagtGcGGGGtActgxaa
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator