Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Vhr1p
Description Transcriptional activator, required for the vitamin H-responsive element (VHRE) mediated induction of VHT1 (Vitamin H transporter) and BIO5 (biotin biosynthesis intermediate transporter) in response to low biotin concentrations
Aminoacid Sequence
Download FASTA
>VHR1 YIL056W
MNGPPTFTQYRINKFSGNGATHKIRELLNFNDEKKWKQFSSRRLELIDKFQLSQYKASEQ
DQNIKQIATILRTEFGYPVSCSKEFEKLVTAAVQSVRRNRKRSKKRYALSIANGSGGNVN
NSISSNSTSDDEISPSIYQRSNSDFLPSSNYAADFQFSNKFQPLMSHQSHNGTIFPTVGT
QNDSSPSVTSTQQKYNDIVTMLVHDLVTNVVPLSEQALKDPYTGPNLSHFATSSLSQQPN
ITTNIPIDSTVPFFLREKLLLQIQRSRTCQDISQAAGSIDIYANLEILGEMSIRMSIAFV
IERFFSNLVSSSMKYITAKTCSPENLALLSQRLFGAATRHNLSHFPAAQVQLRLLYLVIG
GIVKDFGFDPTLYPLSEIIHHIVMVQYPLASSCASEPPSSSPNKRVKRSPPVVSSDVMLN
NNNTLSNRATLLTTLPMKPQSANKDVNRRVIIRFNDREQAFTFHQLSNGPPTVSEVLENC
KNLFNIINKNKNFGIFHNDNLLNDESLAKLFDSFSTSEIHLVIKDISTIPLQDAKIPVPI
TLPKMSCIGENPSMPSIPLVPQEKDDPKKSSLTAFDNILNRISKSPMNEENSNTTLNTGT
STSNTNNNDHNESVPAPYVTKNKNSFQNGNLPQPVFQPLL* 
Transcription Factor
Binding site(s)
gRTGASTCAc
External source Open in SGD external link
w3c xhtml validator w3c css validator